My Cart
You have no items in your shopping cart.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp168403-GMP-200μg | 200μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $629.90 | |
rp168403-GMP-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,889.90 |
GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 971-1023 aa
Product Name | Recombinant Human EGF GMP Protein |
---|---|
Synonyms | Epidermal Growth Factor | beta-urogastrone | EGF | epidermal growth factor (beta-urogastrone) | hEGF | HOMG4 | pro-epidermal growth factor | URG | Urogastrone |
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance |
Specifications & Purity | Animal Free, Carrier Free, GMP, Bioactive, ActiBioPure™, High performance, ≥97%(SDS-PAGE&SEC-HPLC) |
Biochemical and Physiological Mechanisms | EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR |
Bioactivity | Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 20‑100 pg/mL. The specific activity of Recombinant Human EGF is >8.0 x 10^5 IU/mg, which is calibrated against the human EGF WHO International Standard (NIBSC code: 91/530). |
Endotoxin Concentration | <0.1 EU/μg |
Expression System | E. coli |
Amino Acids | 971-1023 aa |
Sequence | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Protein Tag | No tag/C-His tag |
N-terminal Sequence | Met-Asn971-Ser-Asp-Ser-Glu-(Cys)-Pro-Leu-Ser |
Predicted molecular weight | 6 kDa |
SDS-PAGE | 6 kDa under reducing conditions. |
Reconstitution | Reconstitute at 200 μg/mL in PBS. |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |