My Cart
You have no items in your shopping cart.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp156006-10μg (Trial Size) Apply for free trial size(?) Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $19.90 | |
rp156006-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $49.90 | |
rp156006-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $79.90 | |
rp156006-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $439.90 |
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 971-1023 aa
Product Name | Recombinant Human EGF Protein |
---|---|
Synonyms | Beta urogastrone | beta-urogastrone | EGF | EGF_HUMAN | Epidermal growth factor | HOMG4 | OTTHUMP00000219721 | OTTHUMP00000219722 | Pro epidermal growth factor | URG | Urogastrone |
Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, High Performance, ≥95%(SDS-PAGE) |
Biochemical and Physiological Mechanisms | EGF is the prototypic member of a family of growth factors that also includes amphiregulin, betacellulin, epigen, epiregulin, HB-EGF, neuregulins-1 through -6, and TGF-alpha. These proteins contain EGF-like domains with three intramolecular disulfide bond |
Bioactivity | Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.30 ng/mL. |
Endotoxin Concentration | <1.0 EU/μg |
Amino Acids | 971-1023 aa |
Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Predicted molecular weight | 6.2 kDa |
SDS-PAGE | 10.0 kDa, under reducing conditions; 10.0 & 11.3 kDa, under non-reducing conditions. |
Recombinant Human EGF Protein (rp156006) - Protein Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells, The ED50 for this effect is 0.30 ng/mL.
Recombinant Human EGF Protein (rp156006) - SDS-PAGE
3 μg/lane of Recombinant Human EGF Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 10.0 kDa.
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |