| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp170132-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp170132-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp170132-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $479.90 | |
| rp170132-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F cell, C-His tag, 1-265 aa
| Product Name | Recombinant Human EpCAM/TROP1 Protein |
|---|---|
| Synonyms | 323/A3 | ACSTD1 | antigen identified by monoclonal AUA1 | CD326 antigen | CD326 | Cell surface glycoprotein Trop-1 | chromosome 4, surface marker (35kD glycoprotein) | DIAR5 | 17-1A | EGP | EGP-2 | EGP314 | EGP40 | EpCAM | epithelial cell adhesion molecul |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance |
| Product Description | Epithelial Cell Adhesion Molecule (EpCAM), also known as GA733-2 antigen, is a type I transmembrane glycoprotein composed of an extracellular domain with two EGF-Like repeats and a cystenin-rich region, a transmembrane domain and a cytoplasmic domain. It modulates cell adhesion and proliferation. Its overexpression has been detected in many epithelial tumours and has been associated with high stage, high grade and a worse survival in some tumour types. EpCAM has been shown to function as a calcium-independent homophilic cell adhesion molecule that does not exhibit any obvious relationship to the four known cell adhesion molecule superfamilies. However, recent insights have revealed that EpCAM participates in not only cell adhesion, but also in proliferation, migration and differentiation of cells. In addition, recent study revealed that EpCAM is the Wnt-beta-catenin signaling target gene and may be used to facilitate prognosis. It has oncogenic potential and is activated by release of its intracellular domain, which can signal into the cell nucleus by engagement of elements of the wnt pathway. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, High performance, ≥95%(SDS-PAGE) |
| Bioactivity | Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.068 μg/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-265 aa |
| Sequence | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEK |
| Protein Tag | C-His |
| Predicted molecular weight | 28.2 kDa |
| SDS-PAGE | 32.0-42.0 kDa, under reducing conditions |
Recombinant Human EpCAM/TROP1 Protein (rp170132) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.068 μg/mL.
Recombinant Human EpCAM/TROP1 Protein (rp170132) - SDS-PAGE
3 μg/lane of Recombinant Human EpCAM/TROP1 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 32.0-42.0 kDa under reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708473 | Certificate of Analysis | Jul 25, 2024 | rp170132 |
| ZJ24F0708474 | Certificate of Analysis | Jul 25, 2024 | rp170132 |
| ZJ24F0708475 | Certificate of Analysis | Jul 25, 2024 | rp170132 |
| ZJ24R0700782 | Certificate of Analysis | Jul 12, 2024 | rp170132 |
