Recombinant Human Ephrin-A4 Protein, ≥95% (SDS-PAGE), high purity

Features and benefits

Expression System: HEK293
Accession #: P52798
Protein Tag: C-hFc & His
Bioactivity: Immobilized Human EphA7 at 0.5 μg/mL (100 μL/well) can bind Human EFNA4 with a linear range of 0.039-0.942 ng/mL.
Endotoxin Concentration: ＜0.1 EU/μg

Item Number

rp145636

Grouped product items
SKU	Size	Availability	Price
rp145636-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$49.90
rp145636-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$109.90
rp145636-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$169.90
rp145636-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,499.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 26-171 aa

View related series

Basic Description

Product Name	Recombinant Human Ephrin-A4 Protein, ≥95% (SDS-PAGE), high purity
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% (SDS-PAGE) Endotoxin level ＜0.1 EU/μg Function May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	Immobilized Human EphA7 at 0.5 μg/mL (100 μL/well) can bind Human EFNA4 with a linear range of 0.039-0.942 ng/mL.
Endotoxin Concentration	＜0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	26-171 aa
Sequence	LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
Protein Tag	C-hFc & His
Accession #	P52798
Predicted molecular weight	44 kDa
SDS-PAGE	50 kDa, under reducing conditions

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

References

1. Kozlosky, C J CJ and 9 more authors.. (1995) Ligands for the receptor tyrosine kinases hek and elk: isolation of cDNAs encoding a family of proteins.. Oncogene, (19): [PMID:7838529]
2. Aasheim, H C HC and 5 more authors.. (2000) A splice variant of human ephrin-A4 encodes a soluble molecule that is secreted by activated human B lymphocytes.. Blood, (1): [PMID:10607706]
3. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161]
4. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414]

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description