| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145636-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $49.90 | |
| rp145636-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $109.90 | |
| rp145636-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $169.90 | |
| rp145636-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,499.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 26-171 aa
| Product Name | Recombinant Human Ephrin-A4 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | EPH-related receptor tyrosine kinase ligand 4 | LERK-4 | EFL 4 | EFL4 | EFN A4 | EFNA 4 | EFNA4 | EFNA4_HUMAN | Eph related receptor tyrosine kinase ligand 4 | EPH-related receptor tyrosine kinase ligand 4 | Ephrin-A4 | EphrinA4 | EPLG4 | EPLG 4 | LERK 4 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | 1、 Immobilized Human EphA7 at 0.5 μg/mL (100 μL/well) can bind Human EFNA4 with a linear range of 0.039-0.942 ng/mL. 2、Immobilized Recombinant Human EphA2 Protein (rp181601) at 2.0 μg/mL can bind Recombinant Human Ephrin-A4 Protein (rp145636) with the EC5 |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 26-171 aa |
| Sequence | LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG |
| Protein Tag | C-hFc & His |
| Accession # | P52798 |
| Predicted molecular weight | 44 kDa |
| SDS-PAGE | 50 kDa, under reducing conditions; 110 kDa, under non-reducing conditions. |
Recombinant Human Ephrin-A4 Protein (rp145636) - Protein Bioactivity
Immobilized Recombinant Human EphA2 Protein (rp181601) at 2.0 μg/mL can bind Recombinant Human Ephrin-A4 Protein (rp145636) with the EC50 of 7.41 ng/mL.
Recombinant Human Ephrin-A4 Protein (rp145636) - Protein Bioactivity
Immobilized Recombinant Human EphA4 Protein (rp183616) at 2.0 μg/mL can bind Human Recombinant Ephrin-A4 Protein (rp145636) with the EC50 of 8.85 ng/mL.
Recombinant Human Ephrin-A4 Protein (rp145636) - SDS-PAGE
3 μg/lane of Recombinant Human Ephrin-A4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 50 kDa under reducing condition and 110 kDa under non-reducing condition.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
| 1. Kozlosky, C J CJ and 9 more authors.. (1995) Ligands for the receptor tyrosine kinases hek and elk: isolation of cDNAs encoding a family of proteins.. Oncogene, (19): [PMID:7838529] |
| 2. Aasheim, H C HC and 5 more authors.. (2000) A splice variant of human ephrin-A4 encodes a soluble molecule that is secreted by activated human B lymphocytes.. Blood, (1): [PMID:10607706] |
| 3. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 4. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414] |
