Skip to the beginning of the images gallery

Recombinant Human Ephrin-B1 Protein, ≥95% (SDS-PAGE), high purity

≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Accession #: P98172
Protein Tag: C-hFc & His
Bioactivity: When Recombinant Mouse EphB3 Fc Chimera is coated at 2 μg/mL, Recombinant Human Ephrin-B1 Fc Chimera binds with an apparent KD <0.2 nM.
Endotoxin Concentration: ＜0.1 EU/μg

Item Number

rp145638

Grouped product items
SKU	Size	Availability	Price
rp145638-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$69.90
rp145638-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$169.90
rp145638-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$259.90
rp145638-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,999.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 28-232 aa

View related series

Click to view protein information: EFNB1

Accession#: P98172 EFNB1 Ephrin-B1 Gene ID: 1947

Basic Description

Product Name	Recombinant Human Ephrin-B1 Protein, ≥95% (SDS-PAGE), high purity
Synonyms	EFL-3 \| ELK ligand \| ELK-L \| EPH-related receptor tyrosine kinase ligand 2 \| LERK-2 \| CFND \| CFNS \| Craniofrontonasal syndrome (craniofrontonasal dysplasia) \| EFL 3 \| EFL-3 \| EFL3 \| EFNB1 \| EFNB1_HUMAN \| Elk L \| ELK ligand \| Eph related receptor tyrosine
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% (SDS-PAGE) Endotoxin level ＜0.1 EU/μg Function Binds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	When Recombinant Mouse EphB3 Fc Chimera is coated at 2 μg/mL, Recombinant Human Ephrin-B1 Fc Chimera binds with an apparent KD <0.2 nM.
Endotoxin Concentration	＜0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	28-232 aa
Sequence	LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP
Protein Tag	C-hFc & His
Accession #	P98172
Predicted molecular weight	50 kDa
SDS-PAGE	65-70 kDa, under reducing conditions

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0708030	Certificate of Analysis	Jul 12, 2024	rp145638
ZJ24F0708029	Certificate of Analysis	Jul 12, 2024	rp145638
ZJ24F0708028	Certificate of Analysis	Jul 12, 2024	rp145638

References

1. Davis, S S and 7 more authors.. (1994) Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity.. Science (New York, N.Y.), (4): [PMID:7973638]
2. Beckmann, M P MP and 9 more authors.. (1994) Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors.. The EMBO journal, (15): [PMID:8070404]
3. Brückner, K K and 5 more authors.. (1999) EphrinB ligands recruit GRIP family PDZ adaptor proteins into raft membrane microdomains.. Neuron, [PMID:10197531]
4. Wieland, Ilse I and 7 more authors.. (2004) Mutations of the ephrin-B1 gene cause craniofrontonasal syndrome.. American journal of human genetics, [PMID:15124102]
5. Twigg, Stephen R F SR and 7 more authors.. (2004) Mutations of ephrin-B1 (EFNB1), a marker of tissue boundary formation, cause craniofrontonasal syndrome.. Proceedings of the National Academy of Sciences of the United States of America, (8): [PMID:15166289]
6. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161]
7. Ross, Mark T MT and 281 more authors.. (2005) The DNA sequence of the human X chromosome.. Nature, (17): [PMID:15772651]
8. Wieland, Ilse I and 14 more authors.. (2005) Twenty-six novel EFNB1 mutations in familial and sporadic craniofrontonasal syndrome (CFNS).. Human mutation, [PMID:15959873]
9. Tomita, Taisuke T, Tanaka, Sayaka S, Morohashi, Yuichi Y and Iwatsubo, Takeshi T.. (2006) Presenilin-dependent intramembrane cleavage of ephrin-B1.. Molecular neurodegeneration, (12): [PMID:16930449]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.