| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145638-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp145638-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $169.90 | |
| rp145638-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $259.90 | |
| rp145638-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,999.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 28-232 aa
| Product Name | Recombinant Human Ephrin-B1 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | EFL-3 | ELK ligand | ELK-L | EPH-related receptor tyrosine kinase ligand 2 | LERK-2 | CFND | CFNS | Craniofrontonasal syndrome (craniofrontonasal dysplasia) | EFL 3 | EFL-3 | EFL3 | EFNB1 | EFNB1_HUMAN | Elk L | ELK ligand | Eph related receptor tyrosine |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human EphB3 Chimera Protein (rp184031) at 2.0 μg/mL can bind Recombinant Human Ephrin-B1 Protein (rp145638) with the ED50 of 139.2 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 28-232 aa |
| Sequence | LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Protein Tag | C-hFc & His |
| Accession # | P98172 |
| Predicted molecular weight | 50 kDa |
| SDS-PAGE | 55 - 65 kDa, under reducing conditions; 55 - 60 &120 - 140 kDa, under non-reducing conditions. |
Recombinant Human Ephrin-B1 Protein (rp145638) - Protein Bioactivity
Immobilized Recombinant Human EphB3 Chimera Protein (rp184031) at 2.0 μg/mL can bind Recombinant Human Ephrin-B1 Protein (rp145638) with the ED50 of 139.2 ng/mL.
Recombinant Human Ephrin-B1 Protein (rp145638) - SDS-PAGE
3 μg/lane of Recombinant Human Ephrin-B1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 55 - 65 kDa under reducing condition and 55 - 60 &120 - 140 kDa under non-reducing condition.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708030 | Certificate of Analysis | Jul 12, 2024 | rp145638 |
| ZJ24F0708029 | Certificate of Analysis | Jul 12, 2024 | rp145638 |
| ZJ24F0708028 | Certificate of Analysis | Jul 12, 2024 | rp145638 |
| 1. Davis, S S and 7 more authors.. (1994) Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity.. Science (New York, N.Y.), (4): [PMID:7973638] |
| 2. Beckmann, M P MP and 9 more authors.. (1994) Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors.. The EMBO journal, (15): [PMID:8070404] |
| 3. Brückner, K K and 5 more authors.. (1999) EphrinB ligands recruit GRIP family PDZ adaptor proteins into raft membrane microdomains.. Neuron, [PMID:10197531] |
| 4. Wieland, Ilse I and 7 more authors.. (2004) Mutations of the ephrin-B1 gene cause craniofrontonasal syndrome.. American journal of human genetics, [PMID:15124102] |
| 5. Twigg, Stephen R F SR and 7 more authors.. (2004) Mutations of ephrin-B1 (EFNB1), a marker of tissue boundary formation, cause craniofrontonasal syndrome.. Proceedings of the National Academy of Sciences of the United States of America, (8): [PMID:15166289] |
| 6. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 7. Ross, Mark T MT and 281 more authors.. (2005) The DNA sequence of the human X chromosome.. Nature, (17): [PMID:15772651] |
| 8. Wieland, Ilse I and 14 more authors.. (2005) Twenty-six novel EFNB1 mutations in familial and sporadic craniofrontonasal syndrome (CFNS).. Human mutation, [PMID:15959873] |
| 9. Tomita, Taisuke T, Tanaka, Sayaka S, Morohashi, Yuichi Y and Iwatsubo, Takeshi T.. (2006) Presenilin-dependent intramembrane cleavage of ephrin-B1.. Molecular neurodegeneration, (12): [PMID:16930449] |
