| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145645-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $99.90 | |
| rp145645-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $327.90 | |
| rp145645-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $537.90 | |
| rp145645-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,987.90 |
Animal Free, >98% (SDS-PAGE and HPLC), Active, E. coli, No tag, 24-95aa
| Product Name | Recombinant Human Epigen Protein, ＞98% (SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | EPG | Epithelial mitogen |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >95% SDS-PAGE. Greater than 98% by SDS-PAGE and HPLC analyses.Endotoxin level is less than 0.1 ng per µg (1EU/µg). Function Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | ＞98% (SDS-PAGE and HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 300 ng/ml, corresponding to a specific activity of > 3.3 × 103 IU/mg. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 24-95aa |
| Sequence | AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA |
| Protein Tag | No tag |
| Accession # | Q6UW88 |
| Predicted molecular weight | 7.9 kDa |
| SDS-PAGE | 7.9 kDa |
Recombinant Human Epigen Protein (rp145645)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 300 ng/mL, corresponding to a specific activity of > 3.3 × 10³ IU/mg.
Recombinant Human Epigen Protein (rp145645)-SDS-PAGE
Recombinant Human Epigen Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 7.9 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 °C as supplied.1 month, 2 to 8 °C under sterile conditions after reconstitution.3 months, -20 to -70 °C under sterile conditions after reconstitu |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600338 | Certificate of Analysis | Mar 26, 2024 | rp145645 |
| ZJ23F0600339 | Certificate of Analysis | Mar 26, 2024 | rp145645 |
| ZJ23F0600340 | Certificate of Analysis | Mar 26, 2024 | rp145645 |
| 1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] [10.1021/op500134e] |
| 2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] [10.1021/op500134e] |
| 3. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 4. Kochupurakkal, Bose S BS and 15 more authors.. (2005) Epigen, the last ligand of ErbB receptors, reveals intricate relationships between affinity and mitogenicity.. The Journal of biological chemistry, (4): [PMID:15611079] |
