Skip to the beginning of the images gallery

Recombinant Human ErbB3/HER3 Protein

≥90%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Protein Tag: C-His
Bioactivity: Immobilized Recombinant Human ErbB3 / HER3 Protein (rp170123) at 1.0 μg/mL can bind Barecetamab (anti-ERBB3) (Ab182928) with the EC50 of 14.55 ng/mL. Immobilized Recombinant Human ErbB3 / HER3 Protein (rp170123) at 1.0 μg/mL can bind Lumretuzumab (anti-ER
Endotoxin Concentration: ＜1.0 EU/μg

Item Number

rp170123

Grouped product items
SKU	Size	Availability	Price
rp170123-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp170123-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$329.90
rp170123-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$569.90
rp170123-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,899.90

Animal Free, ≥90% (SDS-PAGE), Active, 293F cell, C-His tag, 1-645 aa

Basic Description

Product Name	Recombinant Human ErbB3/HER3 Protein
Synonyms	EC 2.7.10 \| EC 2.7.10.1 \| ErbB3 \| ErbB-3 \| erbB3-S \| HER3 \| HER3c-erbB-3 \| LCCS2 \| lethal congenital contracture syndrome 2 \| MDA-BF-1 \| MGC88033 \| p180-ErbB3 \| p45-sErbB3 \| c-erbB3 \| p85-sErbB3 \| Proto-oncogene-like protein c-ErbB-3 \| receptor tyrosine-p
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free
Product Description	Protein Function:： ErbB3, also known as Her3(human epidermal growth factor receptor3), is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound glycoprotein has a neuregulin binding domain but has not an active kinase domain., and therefore can not mediate the intracellular signal transduction through protein phosphorylation. However, its heterodimer with ErbB2 or other EGFR members responsible for tyrosine phosphorylation forms a receptor complex with high affinity, and initiates the related pathway which lead to cell proliferation or differentiation. ErbB3 has been shown to implicated in numerous cancers, including prostate, bladder, and breast tumors. This protein has different isoforms derived from alternative splicing variants, and among which, the secreted isoform lacking the intermembrane region modulates the activity of membrane-bound form.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥90%(SDS-PAGE)
Bioactivity	Immobilized Recombinant Human ErbB3 / HER3 Protein (rp170123) at 1.0 μg/mL can bind Barecetamab (anti-ERBB3) (Ab182928) with the EC50 of 14.55 ng/mL. Immobilized Recombinant Human ErbB3 / HER3 Protein (rp170123) at 1.0 μg/mL can bind Lumretuzumab (anti-ER
Endotoxin Concentration	＜1.0 EU/μg
Expression System	HEK293
Amino Acids	1-643 aa
Sequence	MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGAC
Protein Tag	C-His
Predicted molecular weight	69.5 kDa
SDS-PAGE	81.5-101.9 kDa, under reducing conditions; 74.3-99.3 kDa, under non-reducing conditions

Images

Recombinant Human ErbB3/HER3 Protein (rp170123) - ELISA
Immobilized Recombinant Human ErbB3/HER3 Protein (rp170123) at 1.0 μg/mL can bind Barecetamab (anti-ERBB3) (Ab182928) with the EC50 of 14.55 ng/mL.

Recombinant Human ErbB3/HER3 Protein (rp170123) - ELISA
Immobilized Recombinant Human ErbB3/HER3 Protein (rp170123) at 1.0 μg/mL can bind Lumretuzumab (anti-ERBB3) (Ab182754) with the EC50 of 31.62 ng/mL.

Recombinant Human ErbB3/HER3 Protein (rp170123) - ELISA
Immobilized Recombinant Human ErbB3/HER3 Protein (rp170123) at 1.0 μg/mL can bind Seribantumab (anti-ERBB3) (Ab175653) with the EC50 of 17.20 ng/mL.

Recombinant Human ErbB3/HER3 Protein (rp170123) - ELISA
Immobilized Recombinant Human ErbB3/HER3 Protein (rp170123) at 1.0 μg/mL can bind Patritumab (anti-ERBB3) (Ab170705) with the EC50 of 27.08 ng/mL.

Recombinant Human ErbB3/HER3 Protein (rp170123) - SDS-PAGE
3 μg/lane of Recombinant Human ErbB3/HER3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 81.5-101.9 kDa under reducing conditions and 74.3-99.3 kDa under non-reducing conditions.

Product Specifications

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0708306	Certificate of Analysis	Jul 17, 2024	rp170123
ZJ24F0708305	Certificate of Analysis	Jul 17, 2024	rp170123
ZJ24F0708304	Certificate of Analysis	Jul 17, 2024	rp170123
ZJ24R0700772	Certificate of Analysis	Jul 06, 2024	rp170123

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.