| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp156337-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | In stock | $89.90 | |
| rp156337-50μg | 50μg | In stock | $259.90 | |
| rp156337-100μg | 100μg | In stock | $399.90 | |
| rp156337-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,499.90 |
Animal Free, >95% (SDS-PAGE), Active, 293F cell, His tag, 28-193 aa
| Product Name | Recombinant Human Erythropoietin/EPO Protein, >95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | EP | EPO | EPO alpha | Epoetin | Erythropoetin | Erythropoietin precursor | MVCD2 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE), Lot by Lot |
| Purity | >95% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.39 ng/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 28-193 aa |
| Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRENLYFQSHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 20.1 kDa |
| SDS-PAGE | 37.6 kDa, under reducing condition; 37.1 kDa, under non-reducing condition |
Recombinant Human EPO Protein (rp156337) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 0.39 ng/mL.
Recombinant Human EPO Protein (rp156337) - SDS-PAGE
3 μg/lane of Recombinant Human EPO Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 37.6 kDa under reducing conditions and 37.1 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Concentration | Lot by Lot |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0303304 | Certificate of Analysis | Mar 22, 2024 | rp156337 |
| ZJ24F0303303 | Certificate of Analysis | Mar 22, 2024 | rp156337 |
| ZJ24F0303305 | Certificate of Analysis | Mar 22, 2024 | rp156337 |
| ZJ24R0300317 | Certificate of Analysis | Mar 08, 2024 | rp156337 |
