| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp183673-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp183673-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
| rp183673-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp183673-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥90% (SDS-PAGE), E. coli, C-His tag, 1-127 aa
| Product Name | Recombinant Human FABP1/L-FABP Protein |
|---|---|
| Synonyms | FABPL | fatty acid binding protein 1, liver | fatty acid-binding protein, liver | LFABP | L-FABP | L-FABPFatty acid-binding protein 1 | Liver-type fatty acid-binding protein | FABP1 |
| Grade | Carrier Free |
| Product Description | Fatty acid-binding protein, liver, also known as Fatty acid-binding protein 1, Liver-type fatty acid-binding protein, FABP1 and FABPL,is a cytoplasm protein which belongs to thecalycin superfamily and Fatty-acid binding protein (FABP) family. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. FABP1 / FABPL binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. It forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. FABP1 / FABPL may be involved in intracellular lipid transport. |
| Specifications & Purity | Carrier Free, ≥90%(SDS-PAGE) |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 1-127 aa |
| Sequence | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIHHHHHH |
| Protein Tag | C-His |
| N-terminal Sequence | Ser2 |
| Predicted molecular weight | 15.0 kDa |
| SDS-PAGE | 12.3 kDa, under reducing conditions; 12.5 kDa, under non-reducing conditions |
Recombinant Human FABP1/L-FABP Protein (rp183673) - SDS-PAGE
3 μg/lane of Recombinant Human FABP1/L-FABP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.3 kDa under reducing conditions and 12.5 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708300 | Certificate of Analysis | Jul 17, 2024 | rp183673 |
| ZJ24F0708299 | Certificate of Analysis | Jul 17, 2024 | rp183673 |
| ZJ24F0708298 | Certificate of Analysis | Jul 17, 2024 | rp183673 |
| ZJ24R0700774 | Certificate of Analysis | Jul 06, 2024 | rp183673 |
