| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp183674-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $79.90 | |
| rp183674-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $239.90 | |
| rp183674-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp183674-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,399.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, C-His tag, 1-132 aa
| Product Name | Recombinant Human FABP2/I-FABP Protein |
|---|---|
| Synonyms | FABP2 | FABPI | FABPI_HUMAN | Fatty acid binding protein | Fatty acid binding protein 2 intestinal | Fatty acid binding protein intestinal | Fatty acid-binding protein | Fatty acid-binding protein 2 | I FABP | I-FABP | IFABP | intestinal | intestinal FABP |
| Grade | Carrier Free |
| Product Description | Protein Function: |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 1-132 aa |
| Sequence | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 16.1 kDa |
| SDS-PAGE | 16.4 kDa, under reducing conditions; 16.4 kDa, under non-reducing conditions |
Recombinant Human FABP2/I-FABP Protein (rp183674) - SDS-PAGE
1 μg/lane of Recombinant Human FABP2/I-FABP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.4 kDa.
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
|---|---|
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708142 | Certificate of Analysis | Jul 11, 2024 | rp183674 |
| ZJ24F0708141 | Certificate of Analysis | Jul 11, 2024 | rp183674 |
| ZJ24F0708140 | Certificate of Analysis | Jul 11, 2024 | rp183674 |
| ZJ24F0708193 | Certificate of Analysis | Jul 11, 2024 | rp183674 |
