Recombinant Human FABP8/M-FABP Protein

Features and benefits

Item Number

rp183693

Grouped product items
SKU	Size	Availability	Price
rp183693-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$79.90
rp183693-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$239.90
rp183693-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$389.90
rp183693-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,369.90

Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His tag, 2-132 aa

View related series

Basic Description

Product Name	Recombinant Human FABP8/M-FABP Protein
Grade	Carrier Free
Product Description	Protein Function: Myelin P2 protein, also known as PMP2, is a cytosolic protein found primarily in peripheral nerves. It Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. It is similar in amino acid sequence and tertiary structure to fatty acid binding proteins found in the liver, adipocytes, and intestine, its expression is limited to the nervous system. PMP2 is detected only in myelin-producing cells of the central and peripheral nervous systems, the oligodendrocytes and Schwann cells, respectively. PMP2 may play a role in lipid transport protein in Schwann cells. It forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Specifications & Purity	Carrier Free, ≥95%(SDS-PAGE), Lot by Lot
Bioactivity	Testing in progress
Endotoxin Concentration	<1 EU/μg
Expression System	E. coli
Amino Acids	2-132 aa
Sequence	MHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Protein Tag	N-His
Predicted molecular weight	15.7 kDa
SDS-PAGE	15.1 kDa, under reducing conditions; 15.1 kDa, under non-reducing conditions

Concentration

Lot by Lot

Storage Temp

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description