| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145907-25μg | 25μg | In stock | $69.90 | |
| rp145907-100μg | 100μg | In stock | $249.90 | |
| rp145907-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,289.90 |
Animal Free, >95% SDS-PAGE, Active, E.coli, No tag, 16-155 aa
| Product Name | Recombinant human FGF1 protein, ＞95% SDS-PAGE, high purity |
|---|---|
| Synonyms | Acidic fibroblast growth factor aFGF Beta; endothelial cell growth factor Beta; endothelial cell growth factor; ECGF; ECGF beta; ECGF-beta; ECGFA; ECGFB; Endothelial Cell Growth Factor alpha; Endothelial Cell Growth Factor beta; FGF 1; FGF alpha; Fgf1; FG |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >95% as determined by SDS-PAGE and Coomassie blue staining Function The heparin-binding fibroblast growth factors play important roles in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. They are potent mitogens in vitro. Sequence similarities Belongs to the heparin-binding growth factors family. Cellular localization Secreted. Cytoplasm. Cytoplasm > cell cortex. Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A13. Secreted in a complex with SYT1. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95% SDS-PAGE |
| Bioactivity | Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of heparin. The ED₅₀ for this effect is typically <0.5ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 16-155 aa |
| Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAES VGEVYIKSTE TGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVG LKKNGSCKRG PRTHYGQKAILFLPLPVSSD |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P05230 |
| Source | Recombinant |
| Predicted molecular weight | 15.9 kDa |
Recombinant Human FGF1 Protein (rp145907)-Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of heparin. The ED50 for this effect is typically <0.5ng/mL.
Recombinant Human FGF1 Protein (rp145907)-SDS-PAGE
3μg/lane of Recombinant Human FGF1 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 13.3 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | After receiving lyophilized powder protein, centrifuge first, and then r econstitute at 100µg/mL in sterile PBS. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Stable for 12 months from the date of receipt of the product under proper storage andhandling conditions. Avoid repeated freeze-thaw cycles. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101723 | Certificate of Analysis | Nov 20, 2023 | rp145907 |
| ZJ23F1101722 | Certificate of Analysis | Nov 20, 2023 | rp145907 |
| ZJ23F0400117 | Certificate of Analysis | Apr 29, 2023 | rp145907 |
| ZJ23F0400116 | Certificate of Analysis | Apr 29, 2023 | rp145907 |
| 1. Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M. (1996) Receptor specificity of the fibroblast growth factor family.. J Biol Chem, 271 (25): (15292-7). [PMID:8663044] |
| 2. Olsen SK, Ibrahimi OA, Raucci A, Zhang F, Eliseenkova AV, Yayon A, Basilico C, Linhardt RJ, Schlessinger J, Mohammadi M. (2004) Insights into the molecular basis for fibroblast growth factor receptor autoinhibition and ligand-binding promiscuity.. Proc Natl Acad Sci USA, 101 (4): (935-40). [PMID:14732692] |
| 3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] |
| 4. Johnstone KD, Karoli T, Liu L, Dredge K, Copeman E, Li CP, Davis K, Hammond E, Bytheway I, Kostewicz E et al.. (2010) Synthesis and biological evaluation of polysulfated oligosaccharide glycosides as inhibitors of angiogenesis and tumor growth.. J Med Chem, 53 (4): (1686-99). [PMID:20128596] |
| 5. Charnley AK, Convery MA, Lakdawala Shah A, Jones E, Hardwicke P, Bridges A, Ouellette M, Totoritis R, Schwartz B, King BW, Wisnoski DD, Kang J, Eidam PM, Votta BJ, Gough PJ, Marquis RW, Bertin J, Casillas L.. (2015) Crystal structures of human RIP2 kinase catalytic domain complexed with ATP-competitive inhibitors: Foundations for understanding inhibitor selectivity.. Bioorg Med Chem, 23 (21): (7000-7006). [PMID:26455654] |
| 6. Yu, Y L YL and 5 more authors.. (1992) An acidic fibroblast growth factor protein generated by alternate splicing acts like an antagonist.. The Journal of experimental medicine, (1): [PMID:1372643] |
| 7. Chiu, I M IM, Wang, W P WP and Lehtoma, K K.. (1990) Alternative splicing generates two forms of mRNA coding for human heparin-binding growth factor 1.. Oncogene, [PMID:1693186] |
| 8. Zhu, X X and 7 more authors.. (1991) Three-dimensional structures of acidic and basic fibroblast growth factors.. Science (New York, N.Y.), (4): [PMID:1702556] |
| 9. Wang, W P WP, Quick, D D, Balcerzak, S P SP, Needleman, S W SW and Chiu, I M IM.. (1991) Cloning and sequence analysis of the human acidic fibroblast growth factor gene and its preservation in leukemia patients.. Oncogene, [PMID:1717925] |
| 10. Wu, D Q DQ, Kan, M K MK, Sato, G H GH, Okamoto, T T and Sato, J D JD.. (1991) Characterization and molecular cloning of a putative binding protein for heparin-binding growth factors.. The Journal of biological chemistry, (5): [PMID:1885605] |
| 11. Crumley, G G, Dionne, C A CA and Jaye, M M.. (1990) The gene for human acidic fibroblast growth factor encodes two upstream exons alternatively spliced to the first coding exon.. Biochemical and biophysical research communications, (31): [PMID:2393407] |
| 12. Harper, J W JW, Strydom, D J DJ and Lobb, R R RR.. (1986) Human class 1 heparin-binding growth factor: structure and homology to bovine acidic brain fibroblast growth factor.. Biochemistry, (15): [PMID:2427112] |
| 13. Wang, W P WP, Lehtoma, K K, Varban, M L ML, Krishnan, I I and Chiu, I M IM.. (1989) Cloning of the gene coding for human class 1 heparin-binding growth factor and its expression in fetal tissues.. Molecular and cellular biology, [PMID:2474753] |
| 14. Mergia, A A and 8 more authors.. (1989) Structural analysis of the gene for human acidic fibroblast growth factor.. Biochemical and biophysical research communications, (15): [PMID:2590193] |
| 15. Jaye, M M and 9 more authors.. (1986) Human endothelial cell growth factor: cloning, nucleotide sequence, and chromosome localization.. Science (New York, N.Y.), (1): [PMID:3523756] |
| 16. Gimenez-Gallego, G G, Conn, G G, Hatcher, V B VB and Thomas, K A KA.. (1986) The complete amino acid sequence of human brain-derived acidic fibroblast growth factor.. Biochemical and biophysical research communications, (31): [PMID:3527167] |
| 17. Gautschi, P P, Fràter-Schröder, M M and Böhlen, P P.. (1986) Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors.. FEBS letters, (18): [PMID:3732516] |
| 18. Gautschi-Sova, P P, Müller, T T and Böhlen, P P.. (1986) Amino acid sequence of human acidic fibroblast growth factor.. Biochemical and biophysical research communications, (14): [PMID:3778488] |
| 19. Gimenez-Gallego, G G, Conn, G G, Hatcher, V B VB and Thomas, K A KA.. (1986) Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities.. Biochemical and biophysical research communications, (13): [PMID:3964259] |
| 20. Zhao, X M XM, Yeoh, T K TK, Hiebert, M M, Frist, W H WH and Miller, G G GG.. (1993) The expression of acidic fibroblast growth factor (heparin-binding growth factor-1) and cytokine genes in human cardiac allografts and T cells.. Transplantation, [PMID:7504343] |
| 21. Pineda-Lucena, A A and 5 more authors.. (1994) 1H-NMR assignment and solution structure of human acidic fibroblast growth factor activated by inositol hexasulfate.. Journal of molecular biology, (9): [PMID:7521397] |
| 22. Blaber, M M, DiSalvo, J J and Thomas, K A KA.. (1996) X-ray crystal structure of human acidic fibroblast growth factor.. Biochemistry, (20): [PMID:8652550] |
| 23. Pineda-Lucena, A A and 6 more authors.. (1996) Three-dimensional structure of acidic fibroblast growth factor in solution: effects of binding to a heparin functional analog.. Journal of molecular biology, (22): [PMID:8950275] |
| 24. DiGabriele, A D AD and 6 more authors.. (1998) Structure of a heparin-linked biologically active dimer of fibroblast growth factor.. Nature, (25): [PMID:9655399] |
| 25. Lozano, R M RM, Jiménez, M M, Santoro, J J, Rico, M M and Giménez-Gallego, G G.. (1998) Solution structure of acidic fibroblast growth factor bound to 1,3, 6-naphthalenetrisulfonate: a minimal model for the anti-tumoral action of suramins and suradistas.. Journal of molecular biology, (4): [PMID:9719643] |
| 26. Stauber, D J DJ, DiGabriele, A D AD and Hendrickson, W A WA.. (2000) Structural interactions of fibroblast growth factor receptor with its ligands.. Proceedings of the National Academy of Sciences of the United States of America, (4): [PMID:10618369] |
| 27. Plotnikov, A N AN, Hubbard, S R SR, Schlessinger, J J and Mohammadi, M M.. (2000) Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity.. Cell, (12): [PMID:10830168] |
| 28. Pellegrini, L L, Burke, D F DF, von Delft, F F, Mulloy, B B and Blundell, T L TL.. (2000) Crystal structure of fibroblast growth factor receptor ectodomain bound to ligand and heparin.. Nature, (26): [PMID:11069186] |
| 29. Landriscina, M M and 7 more authors.. (2001) Copper induces the assembly of a multiprotein aggregate implicated in the release of fibroblast growth factor 1 in response to stress.. The Journal of biological chemistry, (6): [PMID:11432880] |
| 30. Kim, Jaewon J, Blaber, Sachiko I SI and Blaber, Michael M.. (2002) Alternative type I and I' turn conformations in the beta8/beta9 beta-hairpin of human acidic fibroblast growth factor.. Protein science : a publication of the Protein Society, [PMID:11847269] |
| 31. Skjerpen, Camilla Skiple CS, Wesche, Jørgen J and Olsnes, Sjur S.. (2002) Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor.. The Journal of biological chemistry, (28): [PMID:11964394] |
| 32. Schmutz, Jeremy J and 75 more authors.. (2004) The DNA sequence and comparative analysis of human chromosome 5.. Nature, (16): [PMID:15372022] |
| 33. Eswarakumar, V P VP, Lax, I I and Schlessinger, J J.. (2005) Cellular signaling by fibroblast growth factor receptors.. Cytokine & growth factor reviews, [PMID:15863030] |
| 34. Robinson, Christopher J CJ, Harmer, Nicholas J NJ, Goodger, Sarah J SJ, Blundell, Tom L TL and Gallagher, John T JT.. (2005) Cooperative dimerization of fibroblast growth factor 1 (FGF1) upon a single heparin saccharide may drive the formation of 2:2:1 FGF1.FGFR2c.heparin ternary complexes.. The Journal of biological chemistry, (23): [PMID:16219767] |
| 35. Rajalingam, Dakshinamurthy D and 5 more authors.. (2005) Molecular mechanism of inhibition of nonclassical FGF-1 export.. Biochemistry, (29): [PMID:16300395] |
| 36. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617] |
| 37. Di Serio, Claudia C and 9 more authors.. (2008) The release of fibroblast growth factor-1 from melanoma cells requires copper ions and is mediated by phosphatidylinositol 3-kinase/Akt intracellular signaling pathway.. Cancer letters, (18): [PMID:18400376] |
| 38. Mori, Seiji S and 10 more authors.. (2008) Direct binding of integrin alphavbeta3 to FGF1 plays a role in FGF1 signaling.. The Journal of biological chemistry, (27): [PMID:18441324] |
| 39. Fernández, Israel S IS and 10 more authors.. (2010) Gentisic acid, a compound associated with plant defense and a metabolite of aspirin, heads a new class of in vivo fibroblast growth factor inhibitors.. The Journal of biological chemistry, (9): [PMID:20145243] |
| 40. Mohan, Sepuru K SK, Rani, Sandhya G SG and Yu, Chin C.. (2010) The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.. The Journal of biological chemistry, (14): [PMID:20220137] |
| 41. Cao, Renxian R and 5 more authors.. (2010) Effect of human S100A13 gene silencing on FGF-1 transportation in human endothelial cells.. Journal of the Formosan Medical Association = Taiwan yi zhi, [PMID:20863990] |
| 42. Zhen, Yan Y and 7 more authors.. (2012) Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpnα1 and Kpnβ1.. Traffic (Copenhagen, Denmark), [PMID:22321063] |
| 43. Mori, Seiji S and 11 more authors.. (2013) A dominant-negative FGF1 mutant (the R50E mutant) suppresses tumorigenesis and angiogenesis.. PloS one, [PMID:23469107] |
