| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145913-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp145913-25μg | 25μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $269.90 | |
| rp145913-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $599.90 | |
| rp145913-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, >95% SDS-PAGE, Active, E.coli, No tag, Leu40-Ser208
| Product Name | Recombinant Human FGF10 Protein, ＞95% SDS-PAGE, high purity |
|---|---|
| Synonyms | FGF10; FGF-10; fibroblast growth factor 10; Keratinocyte growth factor 2; KGF2; KGF-2; produced by fibroblasts of urinary bladder lamina propria; BB213776; fd11d03; FGF 10; FGF10_HUMAN; wu:fd11d03; zgc:109774 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity ≥ 95% SDS-PAGE. Additional sequence information Mature chain. Function Could be a growth factor active in the process of wound healing. Acts as a mitogen in the lung. May act in a manner similar to FGF-7. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95% SDS-PAGE |
| Bioactivity | Measured in a cell proliferation assay using MCF‑7 human breast cancer cells in the presence of 2 μg/mL of heparin sodium. The ED50 for this effect is typically <21ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 40-208 aa |
| Sequence | LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | O15520 |
| Source | Recombinant |
| Predicted molecular weight | 19.3 kDa |
| SDS-PAGE | 19.8 kDa, under reducing conditions; 19.8 kDa, under non-reducing conditions. |
Recombinant Human FGF10 Protein (rp145913)-Protein Bioactivity
Measured in a cell proliferation assay using MCF‑7 human breast cancer cells in the presence of 2 μg/mL of heparin sodium. The ED₅₀ for this effect is typically <21ng/mL.
Recombinant Human FGF10 Protein (rp145913)-SDS-PAGE
3μg/lane of Recombinant Human FGF10 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 19.8 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Centrifuge first and redissolve with deionized water to proposal concentration. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1001346 | Certificate of Analysis | Oct 19, 2023 | rp145913 |
| ZJ23F1001347 | Certificate of Analysis | Oct 19, 2023 | rp145913 |
| 1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334] |
| 2. Yeh BK, Igarashi M, Eliseenkova AV, Plotnikov AN, Sher I, Ron D, Aaronson SA, Mohammadi M. (2003) Structural basis by which alternative splicing confers specificity in fibroblast growth factor receptors.. Proc Natl Acad Sci USA, 100 (5): (2266-71). [PMID:12591959] |
| 3. Emoto, H H and 10 more authors.. (1997) Structure and expression of human fibroblast growth factor-10.. The Journal of biological chemistry, (12): [PMID:9287324] |
| 4. Entesarian, Miriam M and 12 more authors.. (2005) Mutations in the gene encoding fibroblast growth factor 10 are associated with aplasia of lacrimal and salivary glands.. Nature genetics, [PMID:15654336] |
| 5. Beer, Hans-Dietmar HD and 6 more authors.. (2005) The fibroblast growth factor binding protein is a novel interaction partner of FGF-7, FGF-10 and FGF-22 and regulates FGF activity: implications for epithelial repair.. Oncogene, (11): [PMID:15806171] |
| 6. Rohmann, Edyta E and 21 more authors.. (2006) Mutations in different components of FGF signaling in LADD syndrome.. Nature genetics, [PMID:16501574] |
| 7. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617] |
| 8. Milunsky, J M JM, Zhao, G G, Maher, T A TA, Colby, R R and Everman, D B DB.. (2006) LADD syndrome is caused by FGF10 mutations.. Clinical genetics, [PMID:16630169] |
