| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145924-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp145924-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $269.90 | |
| rp145924-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $499.90 | |
| rp145924-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,559.90 |
Carrier Free, ≥95%(SDS-PAGE), Active, E.coli, N-His tag, 23-216 aa
| Product Name | Recombinant Human FGF17 Protein, ≥95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | FGF-13; FGF17; FGF-17; fibroblast growth factor 17; FGF-13; HH20 |
| Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95%(SDS-PAGE) |
| Bioactivity | Measured by its binding activity of Recombinant Human FGF17 Protein (rp145924) and human FGFR1. The EC50 for this effect is 39.2 - 128.9 ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 23-216 aa |
| Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT |
| Protein Tag | N-His |
| Accession # | O60258 |
| Predicted molecular weight | 26.2kDa |
| SDS-PAGE | 29.1 kDa, under reducing conditions; 29.1 & 56.4 kDa, under non-reducing conditions. |
Recombinant Human FGF17 Protein (rp145924) - Protein Bioactivity
Measured by its binding activity of Recombinant Human FGF17 Protein (rp145924) and human FGFR1. The EC₅₀ for this effect is 39.2 - 128.9 ng/mL.
Recombinant Human FGF17 Protein (rp145924) - SDS-PAGE
3 μg/lane of Recombinant Human FGF17 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 29.1 kDa under reducing conditions and 29.1 & 56.4 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
| Storage Temp | Store at -80°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at 2-8 ℃ for one month. Aliquot and store at -80 ℃ for 12 months. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505408 | Certificate of Analysis | May 15, 2024 | rp145924 |
| ZJ24F0505407 | Certificate of Analysis | May 15, 2024 | rp145924 |
| ZJ24F0505406 | Certificate of Analysis | May 15, 2024 | rp145924 |
