Skip to the beginning of the images gallery

Recombinant Human FGF19 Protein, ＞98% SDS-PAGE, high purity

ActiBioPure™
Animal Free
Azide Free
Bioactive
Carrier Free
≥98%(SDS-PAGE)

Features and benefits

Expression System: E. coli
Accession #: O95750
Protein Tag: N-His
Bioactivity: FGF19 is a member of the fibroblast growth factor (FGF) family. FGFs are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. In general, FGFs are expressed during embryonic development and
Endotoxin Concentration: <1.0 EU/μg

Item Number

rp145934

Grouped product items
SKU	Size	Availability	Price
rp145934-25μg	25μg	In stock	$129.90
rp145934-100μg	100μg	In stock	$399.90
rp145934-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,399.90

Animal Free, >98% SDS-PAGE, Active, E.coli, His, 4~216 aa

View related series

Accession#:O95750 FGF19 Gene ID:9965

Basic Description

Product Name	Recombinant Human FGF19 Protein, ＞98% SDS-PAGE, high purity
Synonyms	FGF19; FGF-19; fibroblast growth factor 19; FGF 19; FGF15; FGF19_HUMAN; Fibroblast growth factor 15; Fibroblast growth factor 19
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥ 98% SDS-PAGE. Function Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥98%(SDS-PAGE)
Purity	＞98% SDS-PAGE
Bioactivity	FGF19 is a member of the fibroblast growth factor (FGF) family. FGFs are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. In general, FGFs are expressed during embryonic development and
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Species	Human
Amino Acids	4-216 aa
Sequence	GCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Protein Tag	N-His
Accession #	O95750
Predicted molecular weight	27.4 kDa
SDS-PAGE	27.7 kDa, under reducing conditions; 27.4 & 54.0 kDa, under non-reducing conditions.

Images

Recombinant Human FGF19 Protein (rp145934) - Protein Bioactivity
FGF19 is a member of the fibroblast growth factor (FGF) family. FGFs are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. In general, FGFs are expressed during embryonic development and in restricted adult tissues. Human FGF-19 cDNA predicts a 251 aa precursor protein with a 22 aa signal peptide and a 229 aa secreted mature protein with no potential N-linked glycosylation sites. FGF19-FGFR1 is one of paired transcripts mediating the dialogues between extraembryonic membrane and endometrium. A functional binding ELISA assay was conducted to detect the interaction of Recombinant Human FGF19 Protein (rp145934) and recombinant human FGFR1, the EC₅₀ for this effect is 0.16 μg/mL.

Recombinant Human FGF19 Protein (rp145934) - SDS-PAGE
3 μg/lane of Recombinant Human FGF19 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 27.7 kDa under reducing conditions and 27.4 & 54.0 kDa under non-reducing conditions.

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0mg/mL. Do not vortex.
Storage Temp	Store at -80°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Avoid repeated freeze/thaw cycles. Store at 2-8℃ for one month. Aliquot and store at -80℃ for 12 month.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

2 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101866	Certificate of Analysis	Dec 01, 2023	rp145934
ZJ23F1101865	Certificate of Analysis	Dec 01, 2023	rp145934

References

1. Holt JA, Luo G, Billin AN, Bisi J, McNeill YY, Kozarsky KF, Donahee M, Wang DY, Mansfield TA, Kliewer SA, Goodwin B, Jones SA. (2003) Definition of a novel growth factor-dependent signal cascade for the suppression of bile acid biosynthesis.. Genes Dev, 17 (13): (1581-91). [PMID:12815072]
2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309]
3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334]
4. Xie MH, Holcomb I, Deuel B, Dowd P, Huang A, Vagts A, Foster J, Liang J, Brush J, Gu Q et al.. (1999) FGF-19, a novel fibroblast growth factor with unique specificity for FGFR4.. Cytokine, 11 (10): (729-35). [PMID:10525310]
5. Kurosu H, Choi M, Ogawa Y, Dickson AS, Goetz R, Eliseenkova AV, Mohammadi M, Rosenblatt KP, Kliewer SA, Kuro-O M. (2007) Tissue-specific expression of betaKlotho and fibroblast growth factor (FGF) receptor isoforms determines metabolic activity of FGF19 and FGF21.. J Biol Chem, 282 (37): (26687-26695). [PMID:17623664]
6. Nishimura, T T, Utsunomiya, Y Y, Hoshikawa, M M, Ohuchi, H H and Itoh, N N.. (1999) Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain.. Biochimica et biophysica acta, (18): [PMID:9931477]
7. Harmer, Nicholas J NJ, Pellegrini, Luca L, Chirgadze, Dima D, Fernandez-Recio, Juan J and Blundell, Tom L TL.. (2004) The crystal structure of fibroblast growth factor (FGF) 19 reveals novel features of the FGF family and offers a structural basis for its unusual receptor affinity.. Biochemistry, (27): [PMID:14730967]
8. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161]
9. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617]
10. Goetz, Regina R and 20 more authors.. (2007) Molecular insights into the klotho-dependent, endocrine mode of action of fibroblast growth factor 19 subfamily members.. Molecular and cellular biology, [PMID:17339340]
11. Wu, Xinle X and 11 more authors.. (2008) C-terminal tail of FGF19 determines its specificity toward Klotho co-receptors.. The Journal of biological chemistry, (28): [PMID:18829467]
12. Song, Kwang-Hoon KH, Li, Tiangang T, Owsley, Erika E, Strom, Stephen S and Chiang, John Y L JY.. (2009) Bile acids activate fibroblast growth factor 19 signaling in human hepatocytes to inhibit cholesterol 7alpha-hydroxylase gene expression.. Hepatology (Baltimore, Md.), [PMID:19085950]
13. Vergnes, Laurent L, Lee, Jessica M JM, Chin, Robert G RG, Auwerx, Johan J and Reue, Karen K.. (2013) Diet1 functions in the FGF15/19 enterohepatic signaling axis to modulate bile acid and lipid levels.. Cell metabolism, (4): [PMID:23747249]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.