Determine the necessary mass, volume, or concentration for preparing a solution.
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp145947-10μg (Trial Size) Apply for free trial size(?) Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $147.90 | |
rp145947-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $507.90 | |
rp145947-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $837.90 | |
rp145947-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,417.90 |
Carrier Free, ≥95% (SDS-PAGE), Active, E.coli, N-His tag, 1-211 aa
Product Name | Recombinant Human FGF20 Protein, ≥95% (SDS-PAGE), high purity |
---|---|
Synonyms | FGF-20; Fgf20; FGF20_HUMAN; FGFK; Fibroblast growth factor 20; RHDA2 |
Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
Purity | ≥95% (SDS-PAGE) |
Species | Human |
Amino Acids | 1-211 aa |
Sequence | MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGHLQILPDGSVQGTRODHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHOKFTHFLPRPVDPERVPELYKDLLMYT |
Protein Tag | N-His tag |
Accession # | Q9NP95 |
Predicted molecular weight | 27.2 kDa |
SDS-PAGE | 27 kDa, under reducing conditions |
Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free |
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
Form | Lyophilized |
---|---|
Reconstitution | Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Storage Temp | Store at -80°C,Avoid repeated freezing and thawing |
Shipped In | Dry ice |
Stability And Storage | Store at 2-8 ℃ for one month. Store at -80 ℃ for 12 months. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
Certificate of Analysis | May 31, 2024 | rp145947 | |
Certificate of Analysis | May 31, 2024 | rp145947 | |
Certificate of Analysis | May 31, 2024 | rp145947 |
1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334] |
2. Kirikoshi, H H and 6 more authors.. (2000) Molecular cloning and characterization of human FGF-20 on chromosome 8p21.3-p22.. Biochemical and biophysical research communications, (2): [PMID:10913340] |
3. Ohmachi, S S and 6 more authors.. (2000) FGF-20, a novel neurotrophic factor, preferentially expressed in the substantia nigra pars compacta of rat brain.. Biochemical and biophysical research communications, (22): [PMID:11032730] |
4. Jeffers, M M and 10 more authors.. (2001) Identification of a novel human fibroblast growth factor and characterization of its role in oncogenesis.. Cancer research, (1): [PMID:11306498] |
5. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617] |
6. Wang, Gaofeng G and 7 more authors.. (2008) Variation in the miRNA-433 binding site of FGF20 confers risk for Parkinson disease by overexpression of alpha-synuclein.. American journal of human genetics, [PMID:18252210] |
7. Wider, Christian C and 20 more authors.. (2009) FGF20 and Parkinson's disease: no evidence of association or pathogenicity via alpha-synuclein expression.. Movement disorders : official journal of the Movement Disorder Society, (15): [PMID:19133659] |
8. Kalinina, Juliya J and 12 more authors.. (2009) Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix.. Molecular and cellular biology, [PMID:19564416] |
9. Barak, Hila H and 11 more authors.. (2012) FGF9 and FGF20 maintain the stemness of nephron progenitors in mice and man.. Developmental cell, (12): [PMID:22698282] |