Click Here for 5% Off Your First Aladdin Purchase!

Recombinant Human FGF20 Protein, ≥95% (SDS-PAGE), high purity(Active)

Features and benefits
  • Specifications & Purity: ActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
  • Protein Tag: N-His tag
Item Number
rp145947
Grouped product items
SKUSizeAvailabilityPrice Qty
rp145947-10μg (Trial Size)
Apply for free trial size(?)
Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$147.90
rp145947-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$507.90
rp145947-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$837.90
rp145947-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$3,417.90

Carrier Free, ≥95% (SDS-PAGE), Active, E.coli, N-His tag, 1-211 aa

Basic Description

Product NameRecombinant Human FGF20 Protein, ≥95% (SDS-PAGE), high purity
SynonymsFGF-20; Fgf20; FGF20_HUMAN; FGFK; Fibroblast growth factor 20; RHDA2
Specifications & PurityActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity≥95% (SDS-PAGE)
SpeciesHuman
Amino Acids1-211 aa
SequenceMAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGHLQILPDGSVQGTRODHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHOKFTHFLPRPVDPERVPELYKDLLMYT
Protein TagN-His tag
Accession #Q9NP95
Predicted molecular weight27.2 kDa
SDS-PAGE27 kDa, under reducing conditions
GradeActiBioPure™, Azide Free, Bioactive, Carrier Free

Associated Targets

FGF20 Tbio Fibroblast growth factor 20 0 Activities

Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)

Product Specifications

FormLyophilized
ReconstitutionReconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Storage TempStore at -80°C,Avoid repeated freezing and thawing
Shipped InDry ice
Stability And StorageStore at 2-8 ℃ for one month. Store at -80 ℃ for 12 months. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0506231Certificate of AnalysisMay 31, 2024 rp145947
ZJ24F0506230Certificate of AnalysisMay 31, 2024 rp145947
ZJ24F0506229Certificate of AnalysisMay 31, 2024 rp145947

Related Documents

References

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al..  (2004)  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)..  Genome Res,  14  (10B): (2121-7).  [PMID:15489334]
2. Kirikoshi, H H and 6 more authors..  (2000)  Molecular cloning and characterization of human FGF-20 on chromosome 8p21.3-p22..  Biochemical and biophysical research communications,    (2):   [PMID:10913340]
3. Ohmachi, S S and 6 more authors..  (2000)  FGF-20, a novel neurotrophic factor, preferentially expressed in the substantia nigra pars compacta of rat brain..  Biochemical and biophysical research communications,    (22):   [PMID:11032730]
4. Jeffers, M M and 10 more authors..  (2001)  Identification of a novel human fibroblast growth factor and characterization of its role in oncogenesis..  Cancer research,    (1):   [PMID:11306498]
5. Zhang, Xiuqin X and 5 more authors..  (2006)  Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family..  The Journal of biological chemistry,    (9):   [PMID:16597617]
6. Wang, Gaofeng G and 7 more authors..  (2008)  Variation in the miRNA-433 binding site of FGF20 confers risk for Parkinson disease by overexpression of alpha-synuclein..  American journal of human genetics,      [PMID:18252210]
7. Wider, Christian C and 20 more authors..  (2009)  FGF20 and Parkinson's disease: no evidence of association or pathogenicity via alpha-synuclein expression..  Movement disorders : official journal of the Movement Disorder Society,    (15):   [PMID:19133659]
8. Kalinina, Juliya J and 12 more authors..  (2009)  Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix..  Molecular and cellular biology,      [PMID:19564416]
9. Barak, Hila H and 11 more authors..  (2012)  FGF9 and FGF20 maintain the stemness of nephron progenitors in mice and man..  Developmental cell,    (12):   [PMID:22698282]

Solution Calculators