Skip to the beginning of the images gallery

Recombinant Human FGF20 Protein, ≥95% (SDS-PAGE), high purity

ActiBioPure™
Azide Free
Bioactive
Carrier Free
≥95%(SDS-PAGE)

Features and benefits

Expression System: E. coli
Accession #: Q9NP95
Protein Tag: N-His
Bioactivity: Measured by its binding activity of recombinant human FGF20 and human FGFR1. The EC50 for this effect is 0.17 ug/mL.
Endotoxin Concentration: <1.0 EU/μg

Item Number

rp145947

Grouped product items
SKU	Size	Availability	Price
rp145947-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$89.90
rp145947-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$299.90
rp145947-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$479.90
rp145947-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$3,339.90

Carrier Free, ≥95% (SDS-PAGE), Active, E.coli, N-His tag, 1-211 aa

View related series

Accession#:Q9NP95 FGF20 Gene ID:26281

Basic Description

Product Name	Recombinant Human FGF20 Protein, ≥95% (SDS-PAGE), high purity
Synonyms	FGF-20; Fgf20; FGF20_HUMAN; FGFK; Fibroblast growth factor 20; RHDA2
Grade	ActiBioPure™, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% (SDS-PAGE) Endotoxin level ＜1.0 EU/μg Function Neurotrophic factor that regulates central nervous development and function.
Specifications & Purity	ActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	Measured by its binding activity of recombinant human FGF20 and human FGFR1. The EC50 for this effect is 0.17 ug/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Species	Human
Amino Acids	1-211 aa
Sequence	MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGHLQILPDGSVQGTRODHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHOKFTHFLPRPVDPERVPELYKDLLMYT
Protein Tag	N-His
Accession #	Q9NP95
Predicted molecular weight	27.2 kDa
SDS-PAGE	27 kDa, under reducing conditions

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Storage Temp	Store at -80°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at 2-8 ℃ for one month. Store at -80 ℃ for 12 months. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0506231	Certificate of Analysis	May 31, 2024	rp145947
ZJ24F0506230	Certificate of Analysis	May 31, 2024	rp145947
ZJ24F0506229	Certificate of Analysis	May 31, 2024	rp145947

References

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334]
2. Kirikoshi, H H and 6 more authors.. (2000) Molecular cloning and characterization of human FGF-20 on chromosome 8p21.3-p22.. Biochemical and biophysical research communications, (2): [PMID:10913340]
3. Ohmachi, S S and 6 more authors.. (2000) FGF-20, a novel neurotrophic factor, preferentially expressed in the substantia nigra pars compacta of rat brain.. Biochemical and biophysical research communications, (22): [PMID:11032730]
4. Jeffers, M M and 10 more authors.. (2001) Identification of a novel human fibroblast growth factor and characterization of its role in oncogenesis.. Cancer research, (1): [PMID:11306498]
5. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617]
6. Wang, Gaofeng G and 7 more authors.. (2008) Variation in the miRNA-433 binding site of FGF20 confers risk for Parkinson disease by overexpression of alpha-synuclein.. American journal of human genetics, [PMID:18252210]
7. Wider, Christian C and 20 more authors.. (2009) FGF20 and Parkinson's disease: no evidence of association or pathogenicity via alpha-synuclein expression.. Movement disorders : official journal of the Movement Disorder Society, (15): [PMID:19133659]
8. Kalinina, Juliya J and 12 more authors.. (2009) Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix.. Molecular and cellular biology, [PMID:19564416]
9. Barak, Hila H and 11 more authors.. (2012) FGF9 and FGF20 maintain the stemness of nephron progenitors in mice and man.. Developmental cell, (12): [PMID:22698282]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.