| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145972-10μg | 10μg | In stock | $479.90 | |
| rp145972-50μg | 50μg | In stock | $1,149.90 | |
| rp145972-100μg | 100μg | In stock | $1,839.90 | |
| rp145972-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $16,999.90 |
Animal Free, ≥95% (SDS-PAGE), Active, E.coli, No tag, 23-204 aa
| Product Name | Recombinant Human FGF8 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | AIGF; AIGFKAL6; Androgen-induced growth factor; FGF8; FGF-8; Fibroblast growth factor 8 (androgen-induced); Fibroblast growth factor 8; HBGF-8; Heparin-binding growth factor 8; MGC149376; HH6; KAL6 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED50 for this effect is typically 0.8-3.3 μg/mL. |
| Endotoxin Concentration | <983 EU/mg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 23-204 aa |
| Sequence | MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVL ENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR |
| Protein Tag | No tag |
| Predicted molecular weight | 21.3 kDa |
| SDS-PAGE | 21.5 kDa, under reducing conditions; 21.5 kDa, under non-reducing conditions. |
Recombinant Human FGF8 Protein (rp145972) - Protein Bioactivity
Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED₅₀ for this effect is typically 0.8-3.3 μg/mL.
Recombinant Human FGF8 Protein (rp145972) - SDS-PAGE
3 μg/lane of Recombinant Human FGF8 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 21.5 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Samples are stable for 12 months from date of receipt at -20℃ to -80℃. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0102324 | Certificate of Analysis | Jan 10, 2024 | rp145972 |
| ZJ24F0102325 | Certificate of Analysis | Jan 10, 2024 | rp145972 |
| ZJ24F0102333 | Certificate of Analysis | Jan 10, 2024 | rp145972 |
| 1. Tanaka, A A, Miyamoto, K K, Matsuo, H H, Matsumoto, K K and Yoshida, H H.. (1995) Human androgen-induced growth factor in prostate and breast cancer cells: its molecular cloning and growth properties.. FEBS letters, (24): [PMID:7737407] |
| 2. Gemel, J J, Gorry, M M, Ehrlich, G D GD and MacArthur, C A CA.. (1996) Structure and sequence of human FGF8.. Genomics, (1): [PMID:8661131] |
| 3. Payson, R A RA, Wu, J J, Liu, Y Y and Chiu, I M IM.. (1996) The human FGF-8 gene localizes on chromosome 10q24 and is subjected to induction by androgen in breast cancer cells.. Oncogene, (4): [PMID:8700553] |
| 4. Ghosh, A K AK and 7 more authors.. (1996) Molecular cloning and characterization of human FGF8 alternative messenger RNA forms.. Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research, [PMID:8891346] |
| 5. Tanaka, S S and 5 more authors.. (2001) A novel isoform of human fibroblast growth factor 8 is induced by androgens and associated with progression of esophageal carcinoma.. Digestive diseases and sciences, [PMID:11341643] |
| 6. Olsen, Shaun K SK and 9 more authors.. (2006) Structural basis by which alternative splicing modulates the organizer activity of FGF8 in the brain.. Genes & development, (15): [PMID:16384934] |
| 7. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617] |
| 8. Falardeau, John J and 20 more authors.. (2008) Decreased FGF8 signaling causes deficiency of gonadotropin-releasing hormone in humans and mice.. The Journal of clinical investigation, [PMID:18596921] |
| 9. Vantaggiato, Chiara C and 8 more authors.. (2011) Senataxin modulates neurite growth through fibroblast growth factor 8 signalling.. Brain : a journal of neurology, [PMID:21576111] |
| 10. Miraoui, Hichem H and 28 more authors.. (2013) Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.. American journal of human genetics, (2): [PMID:23643382] |
