Determine the necessary mass, volume, or concentration for preparing a solution.
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp163960-GMP-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,279.90 | |
rp163960-GMP-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $10,239.90 |
GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 27-181 aa
Product Name | Recombinant Human Flt-3 Ligand/FLT3L GMP Protein |
---|---|
Synonyms | fms-like Tyrosine Kinase 3 Ligand | FL | FLG3L | Flt3 ligand | Flt-3 Ligand | Flt3L | FLT3LG | fms-related tyrosine kinase 3 ligand | SL cytokine | IMD125 |
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance |
Specifications & Purity | Animal Free, Carrier Free, GMP, Bioactive, ActiBioPure™, High performance, ≥97%(SDS-PAGE&SEC-HPLC) |
Biochemical and Physiological Mechanisms | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Bioactivity | Measured in a cell proliferation assay using OCI-AML5 acute myeloid leukemia cells. The ED50 for this effect is 0.200-2.00 ng/mL. The specific activity of Recombinant Human Flt-3 Ligand/FLT3L is >5.00 x 10^5 units/mg, which is calibrated against the human |
Endotoxin Concentration | <0.1 EU/μg |
Expression System | E. coli |
Amino Acids | 27-181 aa |
Sequence | MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA |
Protein Tag | No tag |
N-terminal Sequence | Met-Thr27-Gln-Asp-(Cys)-Ser-Phe-Gln-His-Ser & Thr27-Gln-Asp-(Cys)-Ser-Phe-Gln-His-Ser-Pro |
Predicted molecular weight | 18 kDa |
SDS-PAGE | 17 kDa under reducing conditions. |
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
Reconstitution | Reconstitute at 500 μg/mL in PBS. |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA: