| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp156013-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp156013-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp156013-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $639.90 | |
| rp156013-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His tag, 27-181 aa
| Product Name | Recombinant Human FLT-3 Ligand Protein |
|---|---|
| Grade | Carrier Free |
| Product Description |
Protein Function: |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | E. coli |
| Amino Acids | 27-181 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA |
| Protein Tag | N-His |
| Predicted molecular weight | 19.9 kDa |
| SDS-PAGE | 18.9 kDa, under reducing conditions; 19.5 kDa, under non-reducing conditions |
Recombinant Human FLT-3 Ligand Protein (rp156013) - SDS-PAGE
2 μg/lane of Recombinant Human FLT-3 Ligand Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.9 kDa under reducing conditions and 19.5 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
