| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp146356-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp146356-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $419.90 | |
| rp146356-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $669.90 | |
| rp146356-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,339.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 1-204 aa
| Product Name | Recombinant Human G-CSF Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | G-CSF | Pluripoietin |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.05 pg/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 1-204 aa |
| Sequence | MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQPHHHHHH |
| Protein Tag | C-His |
| Accession # | P09919 |
| Predicted molecular weight | 23 kDa |
| SDS-PAGE | 17.5 kDa, under reducing conditions; 17.5 kDa, under non-reducing conditions. |
Recombinant Human G-CSF Protein (rp146356) - Protein Bioactivity
Measured in a cell proliferation assay using NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.05 pg/mL.
Recombinant Human G-CSF Protein (rp146356) - SDS-PAGE
3 μg/lane of Recombinant Human G-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 17.5 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607424 | Certificate of Analysis | Jun 28, 2024 | rp146356 |
| ZJ24F0607423 | Certificate of Analysis | Jun 28, 2024 | rp146356 |
| ZJ24F0607422 | Certificate of Analysis | Jun 28, 2024 | rp146356 |
| 1. Tamada T, Honjo E, Maeda Y, Okamoto T, Ishibashi M, Tokunaga M, Kuroki R. (2006) Homodimeric cross-over structure of the human granulocyte colony-stimulating factor (GCSF) receptor signaling complex.. Proc Natl Acad Sci USA, 103 (9): (3135-40). [PMID:16492764] |
| 2. Zink, T T, Ross, A A, Ambrosius, D D, Rudolph, R R and Holak, T A TA.. (1992) Secondary structure of human granulocyte colony-stimulating factor derived from NMR spectroscopy.. FEBS letters, (21): [PMID:1281794] |
| 3. Souza, L M LM and 14 more authors.. (1986) Recombinant human granulocyte colony-stimulating factor: effects on normal and leukemic myeloid cells.. Science (New York, N.Y.), (4): [PMID:2420009] |
| 4. Nagata, S S and 8 more authors.. (1986) The chromosomal gene structure and two mRNAs for human granulocyte colony-stimulating factor.. The EMBO journal, [PMID:2423327] |
| 5. Nagata, S S and 9 more authors.. (1986) Molecular cloning and expression of cDNA for human granulocyte colony-stimulating factor.. Nature, [PMID:3484805] |
| 6. Devlin, J J JJ and 5 more authors.. (1987) Expression of granulocyte colony-stimulating factor by human cell lines.. Journal of leukocyte biology, [PMID:3494801] |
| 7. Zink, T T and 5 more authors.. (1994) Structure and dynamics of the human granulocyte colony-stimulating factor determined by NMR spectroscopy. Loop mobility in a four-helix-bundle protein.. Biochemistry, (19): [PMID:7518249] |
| 8. Hill, C P CP, Osslund, T D TD and Eisenberg, D D.. (1993) The structure of granulocyte-colony-stimulating factor and its relationship to other growth factors.. Proceedings of the National Academy of Sciences of the United States of America, (1): [PMID:7685117] |
| 9. Haniu, M M and 5 more authors.. (1995) Extracellular domain of granulocyte-colony stimulating factor receptor. Interaction with its ligand and identification of a domain in close proximity of ligand-binding region.. Archives of biochemistry and biophysics, (20): [PMID:8554326] |
| 10. Aritomi, M M and 5 more authors.. (1999) Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.. Nature, (14): [PMID:10537111] |
| 11. Jin, Pei P and 7 more authors.. (2004) PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.. Genomics, [PMID:15028279] |
| 12. Zody, Michael C MC and 73 more authors.. (2006) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.. Nature, (20): [PMID:16625196] |
