| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp146266-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $79.90 | |
| rp146266-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
| rp146266-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $289.90 | |
| rp146266-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,999.90 |
Animal Free, >98% (SDS-PAGE&HPLC), Active, E.coli, No tag, 2-250 aa
| Product Name | Recombinant Human Galectin 3 Protein, >98% (SDS-PAGE&HPLC), high purity |
|---|---|
| Synonyms | AGE-R3; Carbohydrate-binding protein 35; CBP 35,35 kDa lectin; CBP35; GAL3; Gal-3; galactin-3; Galactose-specific lectin 3; Galactoside-binding protein; GALBPCBP35; Galectin3; Galectin-3; GALIG; IgE-binding protein; L29; L31; L-31; Laminin-binding protein |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | >98% (SDS-PAGE&HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by its ability to agglutinate human red blood cells is less than 10 μg/ml. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 2-250 aa |
| Sequence | ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
| Protein Tag | No tag |
| Accession # | P17931 |
| Predicted molecular weight | 26.0 kDa |
| SDS-PAGE | 26.0 kDa |
Recombinant Human Galectin 3 Protein (rp146266) - Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by its ability to agglutinate human red blood cells is less than 10 μg/mL.
Recombinant Human Galectin 3 Protein (rp146266) - SDS-PAGE
Recombinant Human Galectin 3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apporti |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1001360 | Certificate of Analysis | Oct 19, 2023 | rp146266 |
| ZJ23F1001361 | Certificate of Analysis | Oct 19, 2023 | rp146266 |
| ZJ23F1001362 | Certificate of Analysis | Oct 19, 2023 | rp146266 |
| 1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334] |
| 2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] |
| 3. Thomas R Burkard,Melanie Planyavsky,Ines Kaupe,Florian P Breitwieser,Tilmann Bürckstümmer,Keiryn L Bennett,Giulio Superti-Furga,Jacques Colinge. (2011-01-29) Initial characterization of the human central proteome.. BMC systems biology, 5 (17-17). [PMID:21269460] |
| 4. Oberg CT, Blanchard H, Leffler H, Nilsson UJ.. (2008) Protein subtype-targeting through ligand epimerization: talose-selectivity of galectin-4 and galectin-8.. Bioorg Med Chem Lett, 18 (13): (3691-3694). [PMID:18539029] |
| 5. Delaine T, Cumpstey I, Ingrassia L, Le Mercier M, Okechukwu P, Leffler H, Kiss R, Nilsson UJ.. (2008) Galectin-inhibitory thiodigalactoside ester derivatives have antimigratory effects in cultured lung and prostate cancer cells.. J Med Chem, 51 (24): (8109-8114). [PMID:19053747] |
| 6. Rajput VK, MacKinnon A, Mandal S, Collins P, Blanchard H, Leffler H, Sethi T, Schambye H, Mukhopadhyay B, Nilsson UJ.. (2016) A Selective Galactose-Coumarin-Derived Galectin-3 Inhibitor Demonstrates Involvement of Galectin-3-glycan Interactions in a Pulmonary Fibrosis Model.. J Med Chem, 59 (17): (8141-8147). [PMID:27500311] |
| 7. Gabr M,Rehman AU,Chen HF. (2020) Quinoline-Pyrazole Scaffold as a Novel Ligand of Galectin-3 and Suppressor of TREM2 Signaling.. ACS Med Chem Lett, 11 (9): (1759-1765). [PMID:32944144] |
| 8. Raz, A A and 5 more authors.. (1991) Molecular cloning and chromosomal mapping of a human galactoside-binding protein.. Cancer research, (15): [PMID:2009535] |
| 9. Oda, Y Y, Leffler, H H, Sakakura, Y Y, Kasai, K K and Barondes, S H SH.. (1991) Human breast carcinoma cDNA encoding a galactoside-binding lectin homologous to mouse Mac-2 antigen.. Gene, (15): [PMID:2022338] |
| 10. Robertson, M W MW, Albrandt, K K, Keller, D D and Liu, F T FT.. (1990) Human IgE-binding protein: a soluble lectin exhibiting a highly conserved interspecies sequence and differential recognition of IgE glycoforms.. Biochemistry, (4): [PMID:2261464] |
| 11. Cherayil, B J BJ, Chaitovitz, S S, Wong, C C and Pillai, S S.. (1990) Molecular cloning of a human macrophage lectin specific for galactose.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2402511] |
| 12. Lotz, M M MM and 6 more authors.. (1993) Decreased expression of Mac-2 (carbohydrate binding protein 35) and loss of its nuclear localization are associated with the neoplastic progression of colon carcinoma.. Proceedings of the National Academy of Sciences of the United States of America, (15): [PMID:7682704] |
| 13. Huflejt, M E ME, Turck, C W CW, Lindstedt, R R, Barondes, S H SH and Leffler, H H.. (1993) L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6 and serine 12 in vivo and by casein kinase I.. The Journal of biological chemistry, (15): [PMID:8253806] |
| 14. Kadrofske, M M MM, Openo, K P KP and Wang, J L JL.. (1998) The human LGALS3 (galectin-3) gene: determination of the gene structure and functional characterization of the promoter.. Archives of biochemistry and biophysics, (1): [PMID:9439577] |
| 15. Sasaki, T T, Brakebusch, C C, Engel, J J and Timpl, R R.. (1998) Mac-2 binding protein is a cell-adhesive protein of the extracellular matrix which self-assembles into ring-like structures and binds beta1 integrins, collagens and fibronectin.. The EMBO journal, (16): [PMID:9501082] |
| 16. Seetharaman, J J and 5 more authors.. (1998) X-ray crystal structure of the human galectin-3 carbohydrate recognition domain at 2.1-A resolution.. The Journal of biological chemistry, (22): [PMID:9582341] |
| 17. Heilig, Roland R and 98 more authors.. (2003) The DNA sequence and analysis of human chromosome 14.. Nature, (6): [PMID:12508121] |
| 18. Fukushi, Jun-ichi J, Makagiansar, Irwan T IT and Stallcup, William B WB.. (2004) NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin.. Molecular biology of the cell, [PMID:15181153] |
| 19. Seidel, Ronald D RD, Zhuang, Tiandi T and Prestegard, James H JH.. (2007) Bound-state residual dipolar couplings for rapidly exchanging ligands of His-tagged proteins.. Journal of the American Chemical Society, (18): [PMID:17385862] |
| 20. Than, Nandor Gabor NG and 24 more authors.. (2009) A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death.. Proceedings of the National Academy of Sciences of the United States of America, (16): [PMID:19497882] |
| 21. Haudek, Kevin C and 5 more authors.. (2010) Dynamics of galectin-3 in the nucleus and cytoplasm.. Biochimica et biophysica acta, [PMID:19616076] |
| 22. Zhou, Houjiang H and 6 more authors.. (2013) Toward a comprehensive characterization of a human cancer cell phosphoproteome.. Journal of proteome research, (4): [PMID:23186163] |
| 23. Escoda-Ferran, Cristina C and 8 more authors.. (2014) Modulation of CD6 function through interaction with Galectin-1 and -3.. FEBS letters, (25): [PMID:24945728] |
| 24. Chauhan, Santosh S and 11 more authors.. (2016) TRIMs and Galectins Globally Cooperate and TRIM16 and Galectin-3 Co-direct Autophagy in Endomembrane Damage Homeostasis.. Developmental cell, (10): [PMID:27693506] |
