| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp146383-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $58.90 | |
| rp146383-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp146383-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $229.90 | |
| rp146383-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,799.90 |
Animal Free, >95%(SDS-PAGE and HPLC), Active, E.coli, No tag, 336-455 aa
| Product Name | Recombinant Human GDF6 Protein, ＞95%(SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | Bmp 13;BMP-13;Bmp13;Bone morphogenetic protein 13;Cartilage Derived Morphogenetic Protein 2;Cdmp 2;CDMP2;Gdf 6;GDF-6;GDF16;Gdf6;GDF6_HUMAN;Growth differentiation factor 6;Growth/differentiation factor 16;Growth/differentiation factor 6;KFM;KFS;KFS1;KFSL;K |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity > 95% by SDS-PAGE and HPLC analyses. Function Growth factor that controls proliferation and cellular differentiation in the retina and bone formation. Plays a key role in regulating apoptosis during retinal development. Establishes dorsal-ventral positional information in the retina and controls the formation of the retinotectal map (PubMed:23307924). Required for normal formation of bones and joints in the limbs, skull, digits and axial skeleton. Plays a key role in establishing boundaries between skeletal elements during development. Regulation of GDF6 expression seems to be a mechanism for evolving species-specific changes in skeletal strucutres. Seems to positively regulates differentiation of chondrogenic tissue through the growth factor receptors subunits BMPR1A, BMPR1B, BMPR2 and ACVR2A, leading to the activation of SMAD1-SMAD5-SMAD8 complex. The regulation of chondrogenic differentiation is inhibited by NOG (PubMed:26643732). Also involved in the induction of adipogenesis from mesenchymal stem cells. This mechanism acts through the growth factor receptors subunits BMPR1A, BMPR2 and ACVR2A and the activation of SMAD1-SMAD5-SMAD8 complex and MAPK14/p38. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE&HPLC) |
| Purity | ＞95%(SDS-PAGE and HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED₅₀ as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 2.0 μg/ml, corresponding to a specific activity of > 500 IU/mg. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 336-455aa |
| Sequence | TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | Q6KF10 |
| Source | Recombinant |
| Predicted molecular weight | 27.1 kDa |
| SDS-PAGE | 27.1 kDa |
Recombinant Human GDF6 Protein (rp146383)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 2.0 μg/mL, corresponding to a specific activity of > 500 IU/mg.
Recombinant Human GDF6 Protein (rp146383) - SDS-PAGE
Recombinant Human GDF6 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 27.1 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600317 | Certificate of Analysis | Mar 26, 2024 | rp146383 |
| ZJ23F0600318 | Certificate of Analysis | Mar 26, 2024 | rp146383 |
| ZJ23F0600319 | Certificate of Analysis | Mar 26, 2024 | rp146383 |
| 1. Asai-Coakwell M, March L, Dai XH, Duval M, Lopez I, French CR, Famulski J, De Baere E, Francis PJ, Sundaresan P et al.. (2013) Contribution of growth differentiation factor 6-dependent cell survival to early-onset retinal dystrophies.. Hum Mol Genet, 22 (7): (1432-42). [PMID:23307924] |
| 2. Tassabehji, May M and 12 more authors.. (2008) Mutations in GDF6 are associated with vertebral segmentation defects in Klippel-Feil syndrome.. Human mutation, [PMID:18425797] |
| 3. Asai-Coakwell, Mika M and 24 more authors.. (2009) Incomplete penetrance and phenotypic variability characterize Gdf6-attributable oculo-skeletal phenotypes.. Human molecular genetics, (15): [PMID:19129173] |
| 4. Ye, Ming M and 14 more authors.. (2010) Mutation of the bone morphogenetic protein GDF3 causes ocular and skeletal anomalies.. Human molecular genetics, (15): [PMID:19864492] |
| 5. Chassaing, N N and 26 more authors.. (2014) Molecular findings and clinical data in a cohort of 150 patients with anophthalmia/microphthalmia.. Clinical genetics, [PMID:24033328] |
| 6. Wang, Jian J and 16 more authors.. (2016) A New Subtype of Multiple Synostoses Syndrome Is Caused by a Mutation in GDF6 That Decreases Its Sensitivity to Noggin and Enhances Its Potency as a BMP Signal.. Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, [PMID:26643732] |
| 7. Terhal, Paulien A PA and 7 more authors.. (2018) Further delineation of the GDF6 related multiple synostoses syndrome.. American journal of medical genetics. Part A, [PMID:29130651] |
