| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp146397-10μg | 10μg | In stock | $139.90 | |
| rp146397-50μg | 50μg | In stock | $649.90 | |
| rp146397-100μg | 100μg | In stock | $1,069.90 | |
| rp146397-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,449.90 |
Animal Free, ≥97% (SDS-PAGE), Active, HEK293, No tag, 83-185 aa
| Product Name | Recombinant Human GDNF Protein, ≥97% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Astrocyte-derived trophic factor; ATF; ATF1; ATF2; GDNF; Glial cell derived neurotrophic factor; Glial cell line derived neurotrophic factor; Glial cell line-derived neurotrophic factor; HFB1-GDNF; HGDNF; HSCR3 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE) |
| Purity | ≥97% (SDS-PAGE) |
| Bioactivity | 1. Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 for this effect is typically 3-20 ng/mL in the presence of Recombinant Human GFR alpha-1/GDNF R alpha-1 His Chimera. 2. Immobilized Recombinant Human GDNF Protein |
| Endotoxin Concentration | < 1.0 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 83-185 aa |
| Sequence | GPRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Protein Tag | No tag |
| Predicted molecular weight | 15.1 KDa |
| SDS-PAGE | 15.6 kDa, under reducing conditions; 32.6 kDa, under non-reducing conditions. |
Recombinant Human GDNF Protein (rp146397) - Protein Bioactivity
Immobilized Recombinant Human GDNF Protein (rp146397) at 2 μg/mL can bind biotinylated Recombinant Human GFRA1/GFRα1/GDNFRA Protein, the EC₅₀ is 15.0 - 48.0 ng/mL.
Recombinant Human GDNF Protein (rp146397) - SDS-PAGE
3 μg/lane of Recombinant Human GDNF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 15.6 kDa under reducing conditions and 32.6 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended that sterile water be added to the vial to prepare astock solution of 0.25mg/mL. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Samples are stable for 12 months from date of receipt at -20℃ to -80℃. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101864 | Certificate of Analysis | Dec 01, 2023 | rp146397 |
| ZJ23F1101863 | Certificate of Analysis | Dec 01, 2023 | rp146397 |
| ZJ23F1101862 | Certificate of Analysis | Dec 01, 2023 | rp146397 |
