| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp146403-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
| rp146403-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $249.90 | |
| rp146403-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp146403-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,999.90 |
Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 22-441 aa
| Product Name | Recombinant Human GFR alpha-2/GFRA2 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNF receptor alpha-2; GDNF receptor beta; GDNFR beta; GDNFR-alpha-2; GDNFR-beta; GDNFRB; GFR alpha 2; GFR-alpha-2; GFRA 2; Gfra2; GFRA2_HUMAN; Glial cell line derived neurotrophic factor family |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human Neurturin Protein at 5.0 μg/mL can bind Recombinant Human GFR alpha-2/GFRA2 Protein (rp146403), the EC50 of this effect is 1.99 μg/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 22-441 aa |
| Sequence | SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCR |
| Protein Tag | C-His |
| Accession # | O00451-1 |
| Predicted molecular weight | 47 kDa |
| SDS-PAGE | 75.0 kDa, under reducing conditions; 70.0 kDa, under non-reducing conditions. |
Recombinant Human GFR alpha-2/GFRA2 Protein (rp146403) - Protein Bioactivity
Immobilized Recombinant Human Neurturin Protein at 5.0 μg/mL can bind Recombinant Human GFR alpha-2/GFRA2 Protein (rp146403), the EC₅₀ of this effect is 1.99 μg/mL.
Recombinant Human GFR alpha-2/GFRA2 Protein (rp146403) - SDS-PAGE
3 μg/lane of Recombinant Human GFR alpha-2/GFRA2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 75.0 kDa under reducing conditions and 70.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607373 | Certificate of Analysis | Jun 28, 2024 | rp146403 |
| ZJ24F0607374 | Certificate of Analysis | Jun 28, 2024 | rp146403 |
| ZJ24F0607375 | Certificate of Analysis | Jun 28, 2024 | rp146403 |
