| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp167646-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
| rp167646-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $579.90 | |
| rp167646-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $929.90 | |
| rp167646-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,649.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 19-351 aa
| Product Name | Recombinant Human GFR alpha-like Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | GFR alpha like | GFR alpha-like | GFRAL | GRAL | UNQ9356 | C6orf144 | bA360D14.1 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized Human GFRAL, His Tag at 0.5μg/ml (100μl/Well). Dose response curve for Human GDF15, hFc Tag with the EC50 of 9.4ng/ml. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 19-351 aa |
| Sequence | SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSD |
| Protein Tag | C-His |
| Predicted molecular weight | 39 kDa |
| SDS-PAGE | 40.0 - 50.0 kDa, under reducing conditions; 40.0 - 50.0 kDa, under non-reducing conditions. |
Recombinant Human GFR alpha-like Protein (rp167646) - Protein Bioactivity
Immobilized Recombinant Human GFR alpha-like Protein (rp167646) at 0.5 μg/mL can bind Human GDF15 with the EC
₅₀
of 8.5 ng/mL.
Recombinant Human GFR alpha-like Protein (rp167646) - SDS-PAGE
3 μg/lane of Recombinant Human GFR alpha-like Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40.0 - 50.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607409 | Certificate of Analysis | Jun 28, 2024 | rp167646 |
| ZJ24F0607408 | Certificate of Analysis | Jun 28, 2024 | rp167646 |
| ZJ24F0607407 | Certificate of Analysis | Jun 28, 2024 | rp167646 |
| 1. Mullican SE, Lin-Schmidt X, Chin CN, Chavez JA, Furman JL, Armstrong AA, Beck SC, South VJ, Dinh TQ, Cash-Mason TD et al.. (2017) GFRAL is the receptor for GDF15 and the ligand promotes weight loss in mice and nonhuman primates.. Nat Med, 23 (10): (1150-1157). [PMID:28846097] |
| 2. Emmerson PJ, Wang F, Du Y, Liu Q, Pickard RT, Gonciarz MD, Coskun T, Hamang MJ, Sindelar DK, Ballman KK et al.. (2017) The metabolic effects of GDF15 are mediated by the orphan receptor GFRAL.. Nat Med, 23 (10): (1215-1219). [PMID:28846098] |
| 3. Yang L, Chang CC, Sun Z, Madsen D, Zhu H, Padkjær SB, Wu X, Huang T, Hultman K, Paulsen SJ et al.. (2017) GFRAL is the receptor for GDF15 and is required for the anti-obesity effects of the ligand.. Nat Med, 23 (10): (1158-1166). [PMID:28846099] |
| 4. Hsu, Jer-Yuan JY and 33 more authors.. (2017) Non-homeostatic body weight regulation through a brainstem-restricted receptor for GDF15.. Nature, (12): [PMID:28953886] |
