| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp183683-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp183683-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $249.90 | |
| rp183683-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp183683-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥90% (SDS-PAGE), E. coli, No tag, 2-188 aa
| Product Name | Recombinant Human GGCT Protein |
|---|---|
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥90%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | GGCT belongs to the gamma-glutamylcyclotransferase family. It catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides, the penultimate step in glutathione catabolism. GGCT may play a significant role in glutathione homeostasis. GGCT also in |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | E. coli |
| Amino Acids | 2-188 aa |
| Sequence | ANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL |
| Protein Tag | No tag |
| Predicted molecular weight | 20.8 kDa |
| SDS-PAGE | 22.4-27.9 kDa, under reducing conditions; 20.1-27.4 kDa, under non-reducing conditions |
Recombinant Human GGCT Protein (rp183683)- SDS-PAGE
3μg/lane of Recombinant Human GGCT Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 22.4-27.9 kDa under reducing conditions and 20.1-27.4 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
