| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp143775-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp143775-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $279.90 | |
| rp143775-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $439.90 | |
| rp143775-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-10*His tag, 20-320 aa
| Product Name | Recombinant Human GM-CSF R alpha Protein |
|---|---|
| Synonyms | CDw116 | GMCSFR-alpha | GM-CSF-R-alpha | GMR-alpha | CD116 | CDw116 | colony stimulating factor 2 receptor alpha subunit | colony stimulating factor 2 receptor, alpha, low-affinity(granulocyte-macrophage) | CSF2R | CSF2RA | CSF2RAX | CSF2RAY | CD116 antig |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance |
| Product Description | Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, High performance, ≥95%(SDS-PAGE) |
| Bioactivity | Measured by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 4.67 μg/mL in the presence of 50 pg/mL of human GM-CSF protein. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 20-320 aa |
| Sequence | LIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVS |
| Protein Tag | C-10His |
| Accession # | P15509 |
| Predicted molecular weight | 36.2 kDa |
| SDS-PAGE | 55 - 65 kDa, under reducing conditions; 50 - 65 kDa, under non-reducing conditions. |
Recombinant Human GM-CSF R alpha Protein (rp143775) - Protein Bioactivity
Measured by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells. The ED₅₀
for this effect is 4.67 μg/mL in the presence of 50 pg/mL of human GM-CSF protein.
Recombinant Human GM-CSF R alpha Protein (rp143775) - SDS-PAGE
3 μg/lane of Recombinant Human GM-CSF R alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 50 - 65 kDa.
| Form | Liquid |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
| 1. Rappold, G G, Willson, T A TA, Henke, A A and Gough, N M NM.. (1992) Arrangement and localization of the human GM-CSF receptor alpha chain gene CSF2RA within the X-Y pseudoautosomal region.. Genomics, [PMID:1358805] |
| 2. Crosier, K E KE, Wong, G G GG, Mathey-Prevot, B B, Nathan, D G DG and Sieff, C A CA.. (1991) A functional isoform of the human granulocyte/macrophage colony-stimulating factor receptor has an unusual cytoplasmic domain.. Proceedings of the National Academy of Sciences of the United States of America, (1): [PMID:1715577] |
| 3. Raines, M A MA and 5 more authors.. (1991) Identification and molecular cloning of a soluble human granulocyte-macrophage colony-stimulating factor receptor.. Proceedings of the National Academy of Sciences of the United States of America, (15): [PMID:1832774] |
| 4. Ashworth, A A and Kraft, A A.. (1990) Cloning of a potentially soluble receptor for human GM-CSF.. Nucleic acids research, (11): [PMID:2148207] |
| 5. Gearing, D P DP, King, J A JA, Gough, N M NM and Nicola, N A NA.. (1989) Expression cloning of a receptor for human granulocyte-macrophage colony-stimulating factor.. The EMBO journal, (1): [PMID:2555171] |
| 6. Hu, X X, Emanuel, P D PD and Zuckerman, K S KS.. (1994) Cloning and sequencing of the cDNAs encoding two alternative splicing-derived variants of the alpha subunit of the granulocyte-macrophage colony-stimulating factor receptor.. Biochimica et biophysica acta, (8): [PMID:8086503] |
| 7. Nakagawa, Y Y, Kosugi, H H, Miyajima, A A, Arai, K K and Yokota, T T.. (1994) Structure of the gene encoding the alpha subunit of the human granulocyte-macrophage colony stimulating factor receptor. Implications for the evolution of the cytokine receptor superfamily.. The Journal of biological chemistry, (8): [PMID:8144676] |
| 8. Chen, X X, Ji, Z L ZL and Chen, Y Z YZ.. (2002) TTD: Therapeutic Target Database.. Nucleic acids research, (1): [PMID:11752352] |
| 9. Ross, Mark T MT and 281 more authors.. (2005) The DNA sequence of the human X chromosome.. Nature, (17): [PMID:15772651] |
| 10. Xiao, Rong R and 5 more authors.. (2006) [Expression of soluble GM-CSF-Ralpha in patients with acute myeloid leukemia].. Zhongguo shi yan xue ye xue za zhi, [PMID:16638185] |
| 11. Chen, Jian J, Cárcamo, Juan M JM and Golde, David W DW.. (2006) The alpha subunit of the granulocyte-macrophage colony-stimulating factor receptor interacts with c-Kit and inhibits c-Kit signaling.. The Journal of biological chemistry, (4): [PMID:16760463] |
| 12. Wang, Ying Y and 8 more authors.. (2007) Adaptive secretion of granulocyte-macrophage colony-stimulating factor (GM-CSF) mediates imatinib and nilotinib resistance in BCR/ABL+ progenitors via JAK-2/STAT-5 pathway activation.. Blood, (1): [PMID:17090651] |
| 13. Lencz, T T and 7 more authors.. (2007) Converging evidence for a pseudoautosomal cytokine receptor gene locus in schizophrenia.. Molecular psychiatry, [PMID:17522711] |
| 14. Pelley, Jennifer L JL, Nicholls, Chris D CD, Beattie, Tara L TL and Brown, Christopher B CB.. (2007) Discovery and characterization of a novel splice variant of the GM-CSF receptor alpha subunit.. Experimental hematology, [PMID:17681666] |
| 15. Hansen, Guido G and 12 more authors.. (2008) The structure of the GM-CSF receptor complex reveals a distinct mode of cytokine receptor activation.. Cell, (8): [PMID:18692472] |
| 16. Martinez-Moczygemba, Margarita M and 12 more authors.. (2008) Pulmonary alveolar proteinosis caused by deletion of the GM-CSFRalpha gene in the X chromosome pseudoautosomal region 1.. The Journal of experimental medicine, (24): [PMID:18955567] |
| 17. Suzuki, Takuji T and 14 more authors.. (2008) Familial pulmonary alveolar proteinosis caused by mutations in CSF2RA.. The Journal of experimental medicine, (24): [PMID:18955570] |
| 18. Han, Xuesheng X and Parker, Tory L TL.. (2017) Anti-inflammatory activity of clove (Eugenia caryophyllata) essential oil in human dermal fibroblasts.. Pharmaceutical biology, [PMID:28407719] |
