| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp183586-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp183586-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $259.90 | |
| rp183586-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp183586-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 2-142 aa
| Product Name | Recombinant Human GMFB Protein |
|---|---|
| Grade | Carrier Free |
| Product Description |
This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
|
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | E. coli |
| Amino Acids | 2-142 aa |
| Sequence | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Protein Tag | No tag |
| Predicted molecular weight | 30.2 kDa |
| SDS-PAGE | 15.1 kDa, under reducing conditions; 15.1 kDa, under non-reducing conditions |
Recombinant Human GMFB Protein (rp183586) - SDS-PAGE
3 μg/lane of Recombinant Human GMFB Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.1 kDa.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0707736 | Certificate of Analysis | Jul 05, 2024 | rp183586 |
| ZJ24F0707735 | Certificate of Analysis | Jul 05, 2024 | rp183586 |
| ZJ24F0707734 | Certificate of Analysis | Jul 05, 2024 | rp183586 |
| ZJ24R0600708 | Certificate of Analysis | Jun 23, 2024 | rp183586 |
