| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp181293-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp181293-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
| rp181293-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp181293-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F cell, C-His tag, 1-247 aa
| Product Name | Recombinant Human Granzyme B Protein |
|---|---|
| Synonyms | CCPI | CGL1 | CGL-1 | CSPB | CSP-B | CTLA1 | CTLA-1 | CTSGL1 | Fragmentin-2 | Granzyme B | Granzyme-2 | GranzymeB | GRB | C11 | GrzB | GZMB | HLP | SECT |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Product Description | Granzyme B, also known as GZMB, is the most prominent member of the granzyme family of cell death-inducing serine proteases expressed in the granules of cytotoxic T lymphocytes (CTLs) and NK cells. Granzyme B enters the target cells depending on another membrane-binding granule protein, perforin, results in the activation of effector caspases and mitochondrial depolarization through caspase-dependent and -independent pathways, and consequently induces rapid cell apoptosis. Over 3 substrates of GZMB have been identified including the key substrate caspase-3, ICAD, and Bid. GZMB is suggested to protect the host by lysing cells bearing on their surface 'nonself' antigens such as bacterial and viral infected-cells and tumor cells and accordingly plays an essential role in immunosurveillance. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human Granzyme B Protein (rp181293) at 1.0 μg/mL can bind Granzyme B Antibody (Ab106347) with the EC50 of 1.923 ng/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-247 aa |
| Sequence | MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYHHHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 26.9 kDa |
| SDS-PAGE | 34.6 kDa, under reducing conditions; 34.6 kDa, under non-reducing conditions |
Recombinant Human Granzyme B Protein (rp181293) - ELISA
Immobilized Recombinant Human Granzyme B Protein (rp181293) at 1.0 μg/mL can bind Granzyme B Antibody (Ab106347) with the EC₅₀ of 1.923 ng/mL.
Recombinant Human Granzyme B Protein (rp181293) - SDS-PAGE
3 μg/lane of Recombinant Human Granzyme B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 34.6 kDa.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0707704 | Certificate of Analysis | Jul 05, 2024 | rp181293 |
| ZJ24F0707703 | Certificate of Analysis | Jul 05, 2024 | rp181293 |
| ZJ24F0707702 | Certificate of Analysis | Jul 05, 2024 | rp181293 |
| ZJ24R0600680 | Certificate of Analysis | Jun 14, 2024 | rp181293 |
