| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp146679-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $207.90 | |
| rp146679-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $597.90 | |
| rp146679-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $867.90 | |
| rp146679-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,947.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, Fc&His tag, 27-264 aa
| Product Name | Recombinant Human Growth Hormone R Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | GH receptor | GH-binding protein | GHBP | GHBP, included | GHR | GHR_HUMAN | Growth hormone binding protein | Growth hormone receptor | Growth hormone receptor precursor | Growth hormone-binding protein | Growth hormone-binding protein, included | Increas |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity >95% SDS-PAGE. Function Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling. Post-translational The soluble form (GHBP) is produced by phorbol ester-promoted proteolytic cleavage at the cell surface (shedding) by ADAM17/TACE. Shedding is inhibited by growth hormone (GH) binding to the receptor probably due to a conformational change in GHR rendering the receptor inaccessible to ADAM17. On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2. On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | Immobilized Human GH at 2 μg/mL (100 μL/well) can bind Human GHR with a linear range of 0.1-8.58 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 27-264 aa |
| Sequence | AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Protein Tag | C-Fc & His |
| Accession # | P10912-1 |
| Predicted molecular weight | 54 kDa |
Recombinant Human Growth Hormone R Protein (rp146679) - Protein Bioactivity
Immobilized Human GH at 2.0 μg/mL can bind Recombinant Human Growth Hormone R Protein (rp146679) with a linear range of 0.10 - 8.58 ng/mL. The EC₅₀ is 2.4 ng/mL.
Recombinant Human Growth Hormone R Protein (rp146679) - SDS-PAGE
3 μg/lane of Recombinant Human Growth Hormone R Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 71.4 kDa under reducing conditions and 156.2 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-1.0 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505414 | Certificate of Analysis | May 15, 2024 | rp146679 |
| ZJ24F0505413 | Certificate of Analysis | May 15, 2024 | rp146679 |
| ZJ24F0505412 | Certificate of Analysis | May 15, 2024 | rp146679 |
