Grouped product items

SKU

Size

Availability

Price

Qty

rp170121-10μg (Trial Size)
Apply for free trial size（?）

10μg

In stock

$59.90

rp170121-100μg

100μg

In stock

$299.90

rp170121-1mg

1mg

Available within 8-12 weeks(?)

$1,999.90

Basic Description

Product Name	Recombinant Human GTPase HRAS Protein, >95% (SDS-PAGE), high purity
Synonyms	c-H-ras \| EC 3.6.5.2 \| Ha-Ras \| H-Ras-1 \| p21ras \| Transforming protein p21 \| c-H-ras \| CBAS/HAS \| CHARAS1 \| cHras \| CTLO \| GTPase HRas \| H-Ras-1 \| Ha-Ras \| HAMSV \| HaRas \| HRAS \| HRas1 \| HRASIDX \| KRAS \| N-terminally processed \| NRAS \| p21ras \| RASH_HUMA
Grade	Azide Free, Carrier Free
Product Description	Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： HRas, also known as HRAS, belongs to the small GTPase superfamily, Ras family, and is widely expressed. It functions in signal transduction pathways. HRas can bind GTP and GDP, and they have intrinsic GTPase activity. It undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Defects in HRAS are the cause of faciocutaneoskeletal syndrome (FCSS). FCSS is a rare condition characterized by prenatally increased growth, postnatal growth deficiency, mental retardation, distinctive facial appearance, cardiovascular abnormalities, tumor predisposition, skin, and musculoskeletal abnormalities. Defects in HRAS also can cause congenital myopathy with excess of muscle spindles. HRAS deficiency may be a cause of susceptibility to Hurthle cell thyroid carcinoma. It has been shown that defects in HRAS can cause susceptibility to bladder cancer which is a malignancy originating in tissues of the urinary bladder. It often presents with multiple tumors appearing at different times and different sites in the bladder. Most bladder cancers are transitional cell carcinomas. They begin in cells that normally make up the inner lining of the bladder. Other types of bladder cancer include squamous cell carcinoma (cancer that begins in thin, flat cells) and adenocarcinoma (cancer that begins in cells that make and release mucus and other fluids). Bladder cancer is a complex disorder with both genetic and environmental influences. Defects in HRAS are the cause of oral squamous cell carcinoma.
Specifications & Purity	Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	>95% (SDS-PAGE)
Expression System	E. coli
Amino Acids	2-186 aa
Sequence	MHHHHHHTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Protein Tag	N-His
Predicted molecular weight	21.8 kDa
SDS-PAGE	22.4 kDa, under reducing conditions

Images

Recombinant Human GTPase HRAS Protein (rp170121) - SDS-PAGE
3 μg/lane of Recombinant Human GTPase HRAS Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 22.4 kDa under reducing conditions.

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

2 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0102697	Certificate of Analysis	Feb 06, 2024	rp170121
ZJ24F0102698	Certificate of Analysis	Feb 06, 2024	rp170121

References

1. Nikiforova MN, Lynch RA, Biddinger PW, Alexander EK, Dorn GW, Tallini G, Kroll TG, Nikiforov YE. (2003) RAS point mutations and PAX8-PPAR gamma rearrangement in thyroid tumors: evidence for distinct molecular pathways in thyroid follicular carcinoma.. J Clin Endocrinol Metab, 88 (5): (2318-26). [PMID:12727991]
2. Song C, Hu CD, Masago M, Kariyai K, Yamawaki-Kataoka Y, Shibatohge M, Wu D, Satoh T, Kataoka T. (2001) Regulation of a novel human phospholipase C, PLCepsilon, through membrane targeting by Ras.. J Biol Chem, 276 (4): (2752-7). [PMID:11022048]
3. Moccia M, Frett B, Zhang L, Lakkaniga NR, Briggs DC, Chauhan R, Brescia A, Federico G, Yan W, Santoro M, McDonald NQ, Li HY, Carlomagno F.. (2020) Bioisosteric Discovery of NPA101.3, a Second-Generation RET/VEGFR2 Inhibitor Optimized for Single-Agent Polypharmacology.. J Med Chem, 63 (9): (4506-4516). [PMID:32298114]
4. Kovar SE, Fourman C, Kinstedt C, Williams B, Morris C, Cho KJ, Ketcha DM.. (2020) Chalcones bearing a 3,4,5-trimethoxyphenyl motif are capable of selectively inhibiting oncogenic K-Ras signaling.. Bioorg Med Chem Lett, 30 (11): (127144-127144). [PMID:32276831]
5. Sakai, E E and 7 more authors.. (1992) The p53 tumor-suppressor gene and ras oncogene mutations in oral squamous-cell carcinoma.. International journal of cancer, (2): [PMID:1459726]
6. Tong, L A LA, de Vos, A M AM, Milburn, M V MV and Kim, S H SH.. (1991) Crystal structures at 2.2 A resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with GDP.. Journal of molecular biology, (5): [PMID:1899707]
7. Pai, E F EF and 5 more authors.. (1990) Refined crystal structure of the triphosphate conformation of H-ras p21 at 1.35 A resolution: implications for the mechanism of GTP hydrolysis.. The EMBO journal, [PMID:2196171]
8. de Vos, A M AM and 9 more authors.. (1988) Three-dimensional structure of an oncogene protein: catalytic domain of human c-H-ras p21.. Science (New York, N.Y.), (19): [PMID:2448879]
9. Pai, E F EF and 5 more authors.. (1989) Structure of the guanine-nucleotide-binding domain of the Ha-ras oncogene product p21 in the triphosphate conformation.. Nature, (21): [PMID:2476675]
10. Hancock, J F JF, Magee, A I AI, Childs, J E JE and Marshall, C J CJ.. (1989) All ras proteins are polyisoprenylated but only some are palmitoylated.. Cell, (30): [PMID:2661017]
11. Lacal, J C JC, Anderson, P S PS and Aaronson, S A SA.. (1986) Deletion mutants of Harvey ras p21 protein reveal the absolute requirement of at least two distant regions for GTP-binding and transforming activities.. The EMBO journal, [PMID:3011420]
12. Feig, L A LA, Pan, B T BT, Roberts, T M TM and Cooper, G M GM.. (1986) Isolation of ras GTP-binding mutants using an in situ colony-binding assay.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:3088563]
13. Honkawa, H H, Masahashi, W W, Hashimoto, S S and Hashimoto-Gotoh, T T.. (1987) Identification of the principal promoter sequence of the c-H-ras transforming oncogene: deletion analysis of the 5'-flanking region by focus formation assay.. Molecular and cellular biology, [PMID:3670300]
14. Sekiya, T T and 5 more authors.. (1984) Molecular cloning and the total nucleotide sequence of the human c-Ha-ras-1 gene activated in a melanoma from a Japanese patient.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:6087347]
15. Capon, D J DJ, Chen, E Y EY, Levinson, A D AD, Seeburg, P H PH and Goeddel, D V DV.. (1983) Complete nucleotide sequences of the T24 human bladder carcinoma oncogene and its normal homologue.. Nature, (3): [PMID:6298635]
16. and Reddy, E P EP.. (1983) Nucleotide sequence analysis of the T24 human bladder carcinoma oncogene.. Science (New York, N.Y.), (3): [PMID:6844927]
17. Kraulis, P J PJ, Domaille, P J PJ, Campbell-Burk, S L SL, Van Aken, T T and Laue, E D ED.. (1994) Solution structure and dynamics of ras p21.GDP determined by heteronuclear three- and four-dimensional NMR spectroscopy.. Biochemistry, (29): [PMID:8142349]
18. Dudler, T T and Gelb, M H MH.. (1996) Palmitoylation of Ha-Ras facilitates membrane binding, activation of downstream effectors, and meiotic maturation in Xenopus oocytes.. The Journal of biological chemistry, (10): [PMID:8626715]
19. Scheffzek, K K and 6 more authors.. (1997) The Ras-RasGAP complex: structural basis for GTPase activation and its loss in oncogenic Ras mutants.. Science (New York, N.Y.), (18): [PMID:9219684]
20. Romero, F F, Martínez-A, C C, Camonis, J J and Rebollo, A A.. (1999) Aiolos transcription factor controls cell death in T cells by regulating Bcl-2 expression and its cellular localization.. The EMBO journal, (15): [PMID:10369681]
21. Scheidig, A J AJ, Burmester, C C and Goody, R S RS.. (1999) The pre-hydrolysis state of p21(ras) in complex with GTP: new insights into the role of water molecules in the GTP hydrolysis reaction of ras-like proteins.. Structure (London, England : 1993), (15): [PMID:10574788]
22. Liao, Y Y and 10 more authors.. (1999) RA-GEF, a novel Rap1A guanine nucleotide exchange factor containing a Ras/Rap1A-associating domain, is conserved between nematode and humans.. The Journal of biological chemistry, (31): [PMID:10608844]
23. Topham, M K MK and Prescott, S M SM.. (2001) Diacylglycerol kinase zeta regulates Ras activation by a novel mechanism.. The Journal of cell biology, (19): [PMID:11257115]
24. Pham, N N and Rotin, D D.. (2001) Nedd4 regulates ubiquitination and stability of the guanine-nucleotide exchange factor CNrasGEF.. The Journal of biological chemistry, (14): [PMID:11598133]
25. Hanzal-Bayer, Michael M, Renault, Louis L, Roversi, Pietro P, Wittinghofer, Alfred A and Hillig, Roman C RC.. (2002) The complex of Arl2-GTP and PDE delta: from structure to function.. The EMBO journal, (1): [PMID:11980706]
26. Williams, Jason G JG, Pappu, Kamesh K and Campbell, Sharon L SL.. (2003) Structural and biochemical studies of p21Ras S-nitrosylation and nitric oxide-mediated guanine nucleotide exchange.. Proceedings of the National Academy of Sciences of the United States of America, (27): [PMID:12740440]
27. Guil, Sònia S and 6 more authors.. (2003) Alternative splicing of the human proto-oncogene c-H-ras renders a new Ras family protein that trafficks to cytoplasm and nucleus.. Cancer research, (1): [PMID:14500341]
28. Liu, Fei F, Iqbal, Khalid K, Grundke-Iqbal, Inge I, Rossie, Sandra S and Gong, Cheng-Xin CX.. (2005) Dephosphorylation of tau by protein phosphatase 5: impairment in Alzheimer's disease.. The Journal of biological chemistry, (21): [PMID:15546861]
29. Rocks, Oliver O and 9 more authors.. (2005) An acylation cycle regulates localization and activity of palmitoylated Ras isoforms.. Science (New York, N.Y.), (18): [PMID:15705808]
30. Swarthout, John T JT and 6 more authors.. (2005) DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras.. The Journal of biological chemistry, (2): [PMID:16000296]
31. Aoki, Yoko Y and 10 more authors.. (2005) Germline mutations in HRAS proto-oncogene cause Costello syndrome.. Nature genetics, [PMID:16170316]
32. Gripp, Karen W KW and 14 more authors.. (2006) HRAS mutation analysis in Costello syndrome: genotype and phenotype correlation.. American journal of medical genetics. Part A, (1): [PMID:16329078]
33. Kerr, B B and 25 more authors.. (2006) Genotype-phenotype correlation in Costello syndrome: HRAS mutation analysis in 43 cases.. Journal of medical genetics, [PMID:16443854]
34. Zampino, Giuseppe G and 19 more authors.. (2007) Diversity, parental germline origin, and phenotypic spectrum of de novo HRAS missense changes in Costello syndrome.. Human mutation, [PMID:17054105]
35. Pan, Fan F and 5 more authors.. (2007) Feedback inhibition of calcineurin and Ras by a dual inhibitory protein Carabin.. Nature, (25): [PMID:17230191]
36. van der Burgt, Ineke I and 9 more authors.. (2007) Myopathy caused by HRAS germline mutations: implications for disturbed myogenic differentiation in the presence of constitutive HRas activation.. Journal of medical genetics, [PMID:17412879]
37. Lo, I F M IF and 9 more authors.. (2008) Severe neonatal manifestations of Costello syndrome.. Journal of medical genetics, [PMID:18039947]
38. Buhrman, Greg G, Wink, Glenna G and Mattos, Carla C.. (2007) Transformation efficiency of RasQ61 mutants linked to structural features of the switch regions in the presence of Raf.. Structure (London, England : 1993), [PMID:18073111]
39. Gripp, Karen W KW and 12 more authors.. (2008) Costello syndrome associated with novel germline HRAS mutations: an attenuated phenotype?. American journal of medical genetics. Part A, (15): [PMID:18247425]
40. Stieglitz, Benjamin B and 6 more authors.. (2008) Novel type of Ras effector interaction established between tumour suppressor NORE1A and Ras switch II.. The EMBO journal, (23): [PMID:18596699]
41. Gremer, Lothar L and 8 more authors.. (2010) Duplication of Glu37 in the switch I region of HRAS impairs effector/GAP binding and underlies Costello syndrome by promoting enhanced growth factor-dependent MAPK and AKT activation.. Human molecular genetics, (1): [PMID:19995790]
42. Groesser, Leopold L and 13 more authors.. (2012) Postzygotic HRAS and KRAS mutations cause nevus sebaceous and Schimmelpenning syndrome.. Nature genetics, (10): [PMID:22683711]
43. Gripp, Karen W KW and 7 more authors.. (2012) A novel HRAS substitution (c.266C>G; p.S89C) resulting in decreased downstream signaling suggests a new dimension of RAS pathway dysregulation in human development.. American journal of medical genetics. Part A, [PMID:22821884]
44. Jing, Hui H and 6 more authors.. (2017) SIRT2 and lysine fatty acylation regulate the transforming activity of K-Ras4a.. eLife, (14): [PMID:29239724]
45. Steklov, M M and 24 more authors.. (2018) Mutations in LZTR1 drive human disease by dysregulating RAS ubiquitination.. Science (New York, N.Y.), (7): [PMID:30442762]
46. Tabin, C J CJ and 8 more authors.. (1982) Mechanism of activation of a human oncogene.. Nature, (11): [PMID:6290897]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Recombinant Human GTPase HRAS Protein, >95% (SDS-PAGE), high purity