| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp156635-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | In stock | $139.90 | |
| rp156635-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $499.90 | |
| rp156635-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,999.90 |
Carrier Free, >90% (SDS-PAGE), E.coli, N-His tag, 1-136 aa
| Product Name | Recombinant Human Histone H3 Protein, >90% (SDS-PAGE), high purity |
|---|---|
| Synonyms | H3.5 Protein; Gm14384 Protein; OTTMUSG00000016509 Protein; fj58b09 Protein; wu:fj58b09 Protein; zgc:64222 Protein; H3 histone family member 3C Protein; H3 histone; family 3C Protein; H3F3C Protein; H3f3c Protein; h3f3c Protein; H3 histone family member E |
| Grade | Azide Free, Carrier Free |
| Product Description | Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | Carrier Free, Azide Free, ≥90%(SDS-PAGE) |
| Purity | >90% (SDS-PAGE) |
| Expression System | E. coli |
| Amino Acids | 1-136 aa |
| Sequence | MGHHHHHHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Protein Tag | N-His |
| Predicted molecular weight | 15.4 kDa |
| SDS-PAGE | 16.2 kDa, reducing conditions; 16.2 kDa, non-reducing conditions |
Recombinant Human Histone H3 Protein (rp156635) - SDS-PAGE
Recombinant Human Histone H3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.4 kDa under reducing conditions, showing two bands at 16.2 kDa and 32.0 kDa under non-reducing conditions .
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101867 | Certificate of Analysis | Dec 13, 2023 | rp156635 |
| ZJ23R1100164 | Certificate of Analysis | Nov 24, 2023 | rp156635 |
| 1. Ananthanarayanan M, Li S, Balasubramaniyan N, Suchy FJ, Walsh MJ. (2004) Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1.. J Biol Chem, 279 (52): (54348-57). [PMID:15471871] |
| 2. Marashi, F F and 6 more authors.. (1986) Enhancer-facilitated expression of prokaryotic and eukaryotic genes using human histone gene 5' regulatory sequences.. Biochemistry and cell biology = Biochimie et biologie cellulaire, [PMID:3013246] |
| 3. Zhong, R R, Roeder, R G RG and Heintz, N N.. (1983) The primary structure and expression of four cloned human histone genes.. Nucleic acids research, (11): [PMID:6647026] |
| 4. Ohe, Y Y and Iwai, K K.. (1981) Human spleen histone H3. Isolation and amino acid sequence.. Journal of biochemistry, [PMID:7309716] |
| 5. Goto, H H and 10 more authors.. (1999) Identification of a novel phosphorylation site on histone H3 coupled with mitotic chromosome condensation.. The Journal of biological chemistry, (3): [PMID:10464286] |
| 6. Lachner, M M, O'Carroll, D D, Rea, S S, Mechtler, K K and Jenuwein, T T.. (2001) Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.. Nature, (1): [PMID:11242053] |
| 7. Preuss, Ute U, Landsberg, Gerd G and Scheidtmann, Karl Heinz KH.. (2003) Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.. Nucleic acids research, (1): [PMID:12560483] |
| 8. Huyen, Yentram Y and 9 more authors.. (2004) Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks.. Nature, (18): [PMID:15525939] |
| 9. Dai, Jun J, Sultan, Sammy S, Taylor, Stephen S SS and Higgins, Jonathan M G JM.. (2005) The kinase haspin is required for mitotic histone H3 Thr 3 phosphorylation and normal metaphase chromosome alignment.. Genes & development, (15): [PMID:15681610] |
| 10. Choi, Hong Seok HS and 5 more authors.. (2005) Phosphorylation of Ser28 in histone H3 mediated by mixed lineage kinase-like mitogen-activated protein triple kinase alpha.. The Journal of biological chemistry, (8): [PMID:15684425] |
| 11. Macdonald, Neil N and 12 more authors.. (2005) Molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3.. Molecular cell, (28): [PMID:16246723] |
| 12. Hake, Sandra B SB and 8 more authors.. (2006) Expression patterns and post-translational modifications associated with mammalian histone H3 variants.. The Journal of biological chemistry, (6): [PMID:16267050] |
| 13. Flanagan, John F JF and 8 more authors.. (2005) Double chromodomains cooperate to recognize the methylated histone H3 tail.. Nature, (22): [PMID:16372014] |
| 14. Thomas, C Eric CE, Kelleher, Neil L NL and Mizzen, Craig A CA.. (2006) Mass spectrometric characterization of human histone H3: a bird's eye view.. Journal of proteome research, [PMID:16457588] |
| 15. Miao, Feng F, Li, ShuLian S, Chavez, Valerie V, Lanting, Linda L and Natarajan, Rama R.. (2006) Coactivator-associated arginine methyltransferase-1 enhances nuclear factor-kappaB-mediated gene transcription through methylation of histone H3 at arginine 17.. Molecular endocrinology (Baltimore, Md.), [PMID:16497732] |
| 16. Beck, Hans Christian HC and 8 more authors.. (2006) Quantitative proteomic analysis of post-translational modifications of human histones.. Molecular & cellular proteomics : MCP, [PMID:16627869] |
| 17. Morris, Stephanie A SA and 9 more authors.. (2007) Identification of histone H3 lysine 36 acetylation as a highly conserved histone modification.. The Journal of biological chemistry, (9): [PMID:17189264] |
| 18. Garcia, Benjamin A BA and 10 more authors.. (2007) Organismal differences in post-translational modifications in histones H3 and H4.. The Journal of biological chemistry, (9): [PMID:17194708] |
| 19. Guccione, Ernesto E and 7 more authors.. (2007) Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.. Nature, (18): [PMID:17898714] |
| 20. Metzger, Eric E and 11 more authors.. (2008) Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.. Nature cell biology, [PMID:18066052] |
| 21. Iberg, Aimee N AN and 6 more authors.. (2008) Arginine methylation of the histone H3 tail impedes effector binding.. The Journal of biological chemistry, (8): [PMID:18077460] |
| 22. Hyllus, Dawin D and 7 more authors.. (2007) PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.. Genes & development, (15): [PMID:18079182] |
| 23. Shimada, Midori M and 6 more authors.. (2008) Chk1 is a histone H3 threonine 11 kinase that regulates DNA damage-induced transcriptional repression.. Cell, (25): [PMID:18243098] |
| 24. Metzger, Eric E and 14 more authors.. (2010) Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.. Nature, (1): [PMID:20228790] |
| 25. Vermeulen, Michiel M and 10 more authors.. (2010) Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.. Cell, (17): [PMID:20850016] |
| 26. Wu, Gang and 21 more authors.. (2012) Somatic histone H3 alterations in pediatric diffuse intrinsic pontine gliomas and non-brainstem glioblastomas.. Nature genetics, (29): [PMID:22286216] |
| 27. Yu, Yongxin Y and 7 more authors.. (2012) Histone H3 lysine 56 methylation regulates DNA replication through its interaction with PCNA.. Molecular cell, (13): [PMID:22387026] |
| 28. Yang, Weiwei W and 9 more authors.. (2012) PKM2 phosphorylates histone H3 and promotes gene transcription and tumorigenesis.. Cell, (17): [PMID:22901803] |
| 29. Tropberger, Philipp P and 11 more authors.. (2013) Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer.. Cell, (14): [PMID:23415232] |
| 30. Chan, Kui-Ming KM and 11 more authors.. (2013) The histone H3.3K27M mutation in pediatric glioma reprograms H3K27 methylation and gene expression.. Genes & development, (1): [PMID:23603901] |
| 31. Lu, Chao C and 29 more authors.. (2016) Histone H3K36 mutations promote sarcomagenesis through altered histone methylation landscape.. Science (New York, N.Y.), (13): [PMID:27174990] |
| 32. Li, Lei L and 14 more authors.. (2016) SIRT7 is a histone desuccinylase that functionally links to chromatin compaction and genome stability.. Nature communications, (20): [PMID:27436229] |
| 33. Herranz, Nicolás N and 12 more authors.. (2016) Lysyl oxidase-like 2 (LOXL2) oxidizes trimethylated lysine 4 in histone H3.. The FEBS journal, [PMID:27735137] |
| 34. Papillon-Cavanagh, Simon S and 22 more authors.. (2017) Impaired H3K36 methylation defines a subset of head and neck squamous cell carcinomas.. Nature genetics, [PMID:28067913] |
| 35. Wang, Yugang Y and 17 more authors.. (2017) KAT2A coupled with the α-KGDH complex acts as a histone H3 succinyltransferase.. Nature, (14): [PMID:29211711] |
| 36. Palazzo, Luca L and 5 more authors.. (2018) Serine is the major residue for ADP-ribosylation upon DNA damage.. eLife, (26): [PMID:29480802] |
| 37. Kardalinou, E E, Eick, S S, Albig, W W and Doenecke, D D.. (1993) Association of a human H1 histone gene with an H2A pseudogene and genes encoding H2B.1 and H3.1 histones.. Journal of cellular biochemistry, [PMID:8227173] |
