| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp152533-10μg | 10μg | In stock | $49.90 | |
| rp152533-50μg | 50μg | In stock | $129.90 | |
| rp152533-100μg | 100μg | In stock | $199.90 | |
| rp152533-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,459.90 |
Animal Free, >95% (SDS-PAGE&HPLC), Active, Pichia Pastoris, C-Fc tag, 39-202 aa
| Product Name | Recombinant Human HVEM/TNFRSF14 Protein, >95% (SDS-PAGE&HPLC), high purity |
|---|---|
| Synonyms | ATAR | CD270 antigen | CD270 | CD40-like protein | Herpes virus entry mediator A | Herpesvirus entry mediator A | HveA | HVEM | HVEMTR2HVEAATAR | LIGHTR | TNFRSF14 | tumor necrosis factor receptor superfamily member 14 | tumor necrosis factor receptor sup |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE&HPLC) |
| Purity | >95% (SDS-PAGE&HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta -mediated cytotoxicity using murine L929 cells. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | Pichia pastoris |
| Species | Human |
| Amino Acids | 39-202 aa |
| Sequence | LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Protein Tag | C-Fc |
| Accession # | Q92956 |
| Predicted molecular weight | 58 kDa |
| SDS-PAGE | 70 kDa, under reducing conditions |
Recombinant Human HVEM/TNFRSF14 Protein (rp152533) - SDS-PAGE
Recombinant Human HVEM/TNFRSF14 Protein was resolved with SDS-PAGE under reducing (N) and visualized by Coomassie® Blue staining. Showing a band at 70.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101651 | Certificate of Analysis | Nov 20, 2023 | rp152533 |
| ZJ23F1101650 | Certificate of Analysis | Nov 20, 2023 | rp152533 |
| ZJ23F1101649 | Certificate of Analysis | Nov 20, 2023 | rp152533 |
| 1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] [10.1021/op500134e] |
| 2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] [10.1021/op500134e] |
| 3. Montgomery, R I RI, Warner, M S MS, Lum, B J BJ and Spear, P G PG.. (1996) Herpes simplex virus-1 entry into cells mediated by a novel member of the TNF/NGF receptor family.. Cell, (1): [PMID:8898196] |
| 4. Hsu, H H and 5 more authors.. (1997) ATAR, a novel tumor necrosis factor receptor family member, signals through TRAF2 and TRAF5.. The Journal of biological chemistry, (23): [PMID:9153189] |
| 5. Marsters, S A SA and 5 more authors.. (1997) Herpesvirus entry mediator, a member of the tumor necrosis factor receptor (TNFR) family, interacts with members of the TNFR-associated factor family and activates the transcription factors NF-kappaB and AP-1.. The Journal of biological chemistry, (30): [PMID:9162022] |
| 6. Kwon, B S BS and 15 more authors.. (1997) A newly identified member of the tumor necrosis factor receptor superfamily with a wide tissue distribution and involvement in lymphocyte activation.. The Journal of biological chemistry, (30): [PMID:9162061] |
| 7. Mauri, D N DN and 11 more authors.. (1998) LIGHT, a new member of the TNF superfamily, and lymphotoxin alpha are ligands for herpesvirus entry mediator.. Immunity, [PMID:9462508] |
| 8. Krummenacher, C C and 9 more authors.. (1998) Herpes simplex virus glycoprotein D can bind to poliovirus receptor-related protein 1 or herpesvirus entry mediator, two structurally unrelated mediators of virus entry.. Journal of virology, [PMID:9696799] |
| 9. Tamada, K K and 9 more authors.. (2000) LIGHT, a TNF-like molecule, costimulates T cell proliferation and is required for dendritic cell-mediated allogeneic T cell response.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:10754304] |
| 10. Carfí, A A and 6 more authors.. (2001) Herpes simplex virus glycoprotein D bound to the human receptor HveA.. Molecular cell, [PMID:11511370] |
| 11. Struyf, Frank F and 5 more authors.. (2002) Search for polymorphisms in the genes for herpesvirus entry mediator, nectin-1, and nectin-2 in immune seronegative individuals.. The Journal of infectious diseases, (1): [PMID:11756979] |
| 12. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 13. Compaan, Deanne M DM and 5 more authors.. (2005) Attenuating lymphocyte activity: the crystal structure of the BTLA-HVEM complex.. The Journal of biological chemistry, (25): [PMID:16169851] |
| 14. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414] |
| 15. Cai, Guifang G and 5 more authors.. (2008) CD160 inhibits activation of human CD4+ T cells through interaction with herpesvirus entry mediator.. Nature immunology, [PMID:18193050] |
| 16. Cheung, Timothy C TC and 12 more authors.. (2009) T cell intrinsic heterodimeric complexes between HVEM and BTLA determine receptivity to the surrounding microenvironment.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:19915044] |
| 17. Šedý, John R JR and 8 more authors.. (2013) CD160 activation by herpesvirus entry mediator augments inflammatory cytokine production and cytolytic function by NK cells.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:23761635] |
| 18. Bian, Yangyang Y and 9 more authors.. (2014) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.. Journal of proteomics, (16): [PMID:24275569] |
