Skip to the beginning of the images gallery

Recombinant Human HVEM/TNFRSF14 Protein, >95% (SDS-PAGE&HPLC), high purity

≥95%(SDS-PAGE&HPLC)

Features and benefits

Expression System: Pichia pastoris
Accession #: Q92956
Protein Tag: C-Fc
Bioactivity: Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta -mediated cytotoxicity using murine L929 cells.
Endotoxin Concentration: <0.1 EU/μg

Item Number

rp152533

Grouped product items
SKU	Size	Availability	Price
rp152533-10μg	10μg	In stock	$49.90
rp152533-50μg	50μg	In stock	$129.90
rp152533-100μg	100μg	In stock	$199.90
rp152533-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,459.90

Animal Free, >95% (SDS-PAGE&HPLC), Active, Pichia Pastoris, C-Fc tag, 39-202 aa

View related series

Click to view protein information: TNFRSF14

Accession#:Q92956 Gene ID:8764 HVEM TNFRSF14

Basic Description

Product Name	Recombinant Human HVEM/TNFRSF14 Protein, >95% (SDS-PAGE&HPLC), high purity
Synonyms	ATAR; CD270 antigen; CD270; CD40-like protein; Herpes virus entry mediator A; Herpesvirus entry mediator A; HveA; HVEM; HVEMTR2HVEAATAR; LIGHTR; TNFRSF14; tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, me
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity Function >95% (SDS-PAGE&HPLC) Endotoxin level <0.1 EU/μg Function Receptor for BTLA. Receptor for TNFSF14/LIGHT and homotrimeric TNFSF1/lymphotoxin-alpha. Involved in lymphocyte activation. Plays an important role in HSV pathogenesis because it enhanced the entry of several wild-type HSV strains of both serotypes into CHO cells, and mediated HSV entry into activated human T-cells.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE&HPLC)
Purity	>95% (SDS-PAGE&HPLC)
Bioactivity	Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta -mediated cytotoxicity using murine L929 cells.
Endotoxin Concentration	<0.1 EU/μg
Expression System	Pichia pastoris
Species	Human
Amino Acids	39-202 aa
Sequence	LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
Protein Tag	C-Fc
Accession #	Q92956
Predicted molecular weight	58 kDa
SDS-PAGE	70 kDa, under reducing conditions

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportio
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101651	Certificate of Analysis	Nov 20, 2023	rp152533
ZJ23F1101650	Certificate of Analysis	Nov 20, 2023	rp152533
ZJ23F1101649	Certificate of Analysis	Nov 20, 2023	rp152533

References

1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309]
2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039]
3. Montgomery, R I RI, Warner, M S MS, Lum, B J BJ and Spear, P G PG.. (1996) Herpes simplex virus-1 entry into cells mediated by a novel member of the TNF/NGF receptor family.. Cell, (1): [PMID:8898196]
4. Hsu, H H and 5 more authors.. (1997) ATAR, a novel tumor necrosis factor receptor family member, signals through TRAF2 and TRAF5.. The Journal of biological chemistry, (23): [PMID:9153189]
5. Marsters, S A SA and 5 more authors.. (1997) Herpesvirus entry mediator, a member of the tumor necrosis factor receptor (TNFR) family, interacts with members of the TNFR-associated factor family and activates the transcription factors NF-kappaB and AP-1.. The Journal of biological chemistry, (30): [PMID:9162022]
6. Kwon, B S BS and 15 more authors.. (1997) A newly identified member of the tumor necrosis factor receptor superfamily with a wide tissue distribution and involvement in lymphocyte activation.. The Journal of biological chemistry, (30): [PMID:9162061]
7. Mauri, D N DN and 11 more authors.. (1998) LIGHT, a new member of the TNF superfamily, and lymphotoxin alpha are ligands for herpesvirus entry mediator.. Immunity, [PMID:9462508]
8. Krummenacher, C C and 9 more authors.. (1998) Herpes simplex virus glycoprotein D can bind to poliovirus receptor-related protein 1 or herpesvirus entry mediator, two structurally unrelated mediators of virus entry.. Journal of virology, [PMID:9696799]
9. Tamada, K K and 9 more authors.. (2000) LIGHT, a TNF-like molecule, costimulates T cell proliferation and is required for dendritic cell-mediated allogeneic T cell response.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:10754304]
10. Carfí, A A and 6 more authors.. (2001) Herpes simplex virus glycoprotein D bound to the human receptor HveA.. Molecular cell, [PMID:11511370]
11. Struyf, Frank F and 5 more authors.. (2002) Search for polymorphisms in the genes for herpesvirus entry mediator, nectin-1, and nectin-2 in immune seronegative individuals.. The Journal of infectious diseases, (1): [PMID:11756979]
12. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161]
13. Compaan, Deanne M DM and 5 more authors.. (2005) Attenuating lymphocyte activity: the crystal structure of the BTLA-HVEM complex.. The Journal of biological chemistry, (25): [PMID:16169851]
14. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414]
15. Cai, Guifang G and 5 more authors.. (2008) CD160 inhibits activation of human CD4+ T cells through interaction with herpesvirus entry mediator.. Nature immunology, [PMID:18193050]
16. Cheung, Timothy C TC and 12 more authors.. (2009) T cell intrinsic heterodimeric complexes between HVEM and BTLA determine receptivity to the surrounding microenvironment.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:19915044]
17. Šedý, John R JR and 8 more authors.. (2013) CD160 activation by herpesvirus entry mediator augments inflammatory cytokine production and cytolytic function by NK cells.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:23761635]
18. Bian, Yangyang Y and 9 more authors.. (2014) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.. Journal of proteomics, (16): [PMID:24275569]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.