Calculate the mass, volume, or concentration required for a solution.
Recombinant Human IFN-omega Protein (rp147247) - Protein Bioactivity
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is 0.02 ng/mL.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp147247-20μg (Trial Size) Apply for free trial size(?) Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 20μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $66.90 | |
rp147247-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $210.90 | |
rp147247-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,806.90 |
Animal Free, >95%(SDS-PAGE), Active, E.coli, His, 24-195aa
Product Name | Recombinant Human IFN-omega Protein, >95%(SDS-PAGE), high purity |
---|---|
Synonyms | IFN-omega 1, interferon omega-1; IFNomega; IFN-omega; IFNW1; Interferon alpha-II-1; interferon omega-1; interferon, omega 1 |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
Purity | >95%(SDS-PAGE) |
Species | Human |
Amino Acids | 24 to 195 |
Sequence | MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS |
Protein Tag | His-tag at the C-terminus |
N-terminal Sequence | Met |
Accession # | P05000 |
Predicted molecular weight | 20.93 kDa |
SDS-PAGE | 19.7 kDa, under reducing conditions; 19.7 kDa, under non-reducing conditions. |
Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
Recombinant Human IFN-omega Protein (rp147247) - Protein Bioactivity
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is 0.02 ng/mL.
Recombinant Human IFN-omega Protein (rp147247)- SDS-PAGE
2 μg/lane of Recombinant Human IFN-omega was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.7 kDa.
Form | Lyophilized |
---|---|
Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage Temp | Store at -20°C |
Shipped In | Dry ice |
Stability And Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution,store at 2°C to 8°C for up to 1 week.Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should b |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
Certificate of Analysis | Aug 30, 2023 | rp147247 | |
Certificate of Analysis | Aug 30, 2023 | rp147247 |
1. Adolf, G R GR and 9 more authors.. (1991) Human interferon omega 1: isolation of the gene, expression in Chinese hamster ovary cells and characterization of the recombinant protein.. Biochimica et biophysica acta, (13): [PMID:1647209] |
2. Adolf, G R GR, Maurer-Fogy, I I, Kalsner, I I and Cantell, K K.. (1990) Purification and characterization of natural human interferon omega 1. Two alternative cleavage sites for the signal peptidase.. The Journal of biological chemistry, (5): [PMID:1693148] |
3. Capon, D J DJ, Shepard, H M HM and Goeddel, D V DV.. (1985) Two distinct families of human and bovine interferon-alpha genes are coordinately expressed and encode functional polypeptides.. Molecular and cellular biology, [PMID:2985969] |
4. Hauptmann, R R and Swetly, P P.. (1985) A novel class of human type I interferons.. Nucleic acids research, (11): [PMID:3895159] |
5. Humphray, S J SJ and 147 more authors.. (2004) DNA sequence and analysis of human chromosome 9.. Nature, (27): [PMID:15164053] |
6. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
7. Thomas, Christoph C and 13 more authors.. (2011) Structural linkage between ligand discrimination and receptor activation by type I interferons.. Cell, (19): [PMID:21854986] |