| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147265-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp147265-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp147265-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $229.90 | |
| rp147265-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,899.90 |
Animal Free, >98% (SDS-PAGE&HPLC), Active, E. coli, No tag, 25-91 aa
| Product Name | Recombinant Human IGF2 Protein, >98% (SDS-PAGE&HPLC), high purity |
|---|---|
| Synonyms | C11orf43; Chromosome 11 open reading frame 43; FLJ22066; FLJ44734; GRDF; IGF2; IGF-2; IGFII; IGF-II; Insulin-like growth factor 2 (somatomedin A); Insulin-like growth factor II; Insulin-like growth factor type 2; MSA; PEG2; PP9974; Somatomedin-A; SRS3 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | >98% (SDS-PAGE&HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 25-91 aa |
| Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Protein Tag | No tag |
| Accession # | P01344 |
| Predicted molecular weight | 7.5 kDa |
| SDS-PAGE | 7.5 kDa |
Recombinant Human IGF2 Protein (rp147265) - Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/mL, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
Recombinant Human IGF2 Protein (rp147265) - SDS-PAGE
Recombinant Human IGF2 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining. Showing a single band at 7.5 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1201992 | Certificate of Analysis | Dec 08, 2023 | rp147265 |
| ZJ23F1001343 | Certificate of Analysis | Oct 19, 2023 | rp147265 |
| ZJ23F1001344 | Certificate of Analysis | Oct 19, 2023 | rp147265 |
| ZJ23F1001345 | Certificate of Analysis | Oct 19, 2023 | rp147265 |
