| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147273-5μg | 5μg | In stock | $59.90 | |
| rp147273-25μg | 25μg | In stock | $139.90 | |
| rp147273-100μg | 100μg | In stock | $449.90 | |
| rp147273-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 |
Animal Free, >95% (SDS-PAGE), Active, 293F, C-His tag, 26-259 aa
| Product Name | Recombinant Human IGFBP-1 Protein, ＞95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | alpha-pregnancy-associated endometrial globulin; amniotic fluid binding protein; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; hIGFBP-1; IBP1; IBP-1; IGF-binding protein 1; IGFBP1; IGFBP-1; IGF-BP2 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity >95% SDS-PAGE. Function IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95% (SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human IGFBP-1 at 5 ug/mL (100 uL/well) can bind Recombinant Human IGF1 with a linear range of 40-160 ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 26-259 aa |
| Sequence | APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQNHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 26 kDa |
| SDS-PAGE | 29 kDa under reducing conditions. |
Recombinant Human IGFBP-1 Protein (rp147273) - Protein Bioactivity
Immobilized Recombinant Human IGFBP-1 Protein (rp147273) at 5 ug/mL can bind Recombinant Human IGF1 with a linear range of 40-160 ng/mL.
Recombinant Human IGFBP-1 Protein (rp147273) - SDS-PAGE
2 μg/lane of Recombinant Human IGFBP-1 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 30.6 kDa under reducing condition and 28.6 kDa under non-reducing condition.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -80℃ for 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.；可销售：Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1202255 | Certificate of Analysis | Dec 28, 2023 | rp147273 |
| ZJ23F1202256 | Certificate of Analysis | Dec 28, 2023 | rp147273 |
| ZJ23F1202254 | Certificate of Analysis | Dec 28, 2023 | rp147273 |
