Recombinant Human IL-1 alpha/IL-1F1 Protein, ≥95% (SDS-PAGE), high purity

Item Number

rp147340

• Product Name: Recombinant Human IL-1 alpha/IL-1F1 Protein, ≥95% (SDS-PAGE), high purity
• Synonyms: BAF | Hematopoietin-1 | IL1 alpha | IL-1 alpha | IL1 | IL1A | IL-1A | IL1-ALPHA | IL1F1 | IL-1F1 | IL1F1hematopoietin-1 | interleukin 1, alpha | interleukin-1 alpha | LAF | LEM | preinterleukin 1 alpha | pro-interleukin-1-alpha | FAF | Hematopoietin 1 | I
• Grade: ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
• Purity: ≥95% (SDS-PAGE)
• Bioactivity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 1‑10 ng/mL.
• Endotoxin Concentration: <0.1 EU/μg
• Expression System: HEK293
• Species: Human
• Amino Acids: 113-271 aa
• Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQAHHHHHH
• Protein Tag: C-His
• Accession #: Q53QF9/P01583
• Predicted molecular weight: 18 kDa
• SDS-PAGE: 21 kDa, under reducing conditions

Product Description

Purity
≥95% (SDS-PAGE)
Endotoxin level
＜0.1 EU/μg

Function

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
IL-1α is a non-secreted, proinflammatory cytokine produced in a variety of cells, including monocytes, tissue macrophages, keratinocytes, and other epithelial cells. It possesses metabolic, physiological, hematopoietic activities, and plays one of the central roles in the regulation of the immune responses. Both IL-1α and IL-1β bind to the same receptor and have similar, if not identical, biological properties. These cytokines have a broad range of activities including the stimulation of thymocyte proliferation by inducing IL-2 release, B cell maturation and proliferation, mitogenic FGF-like activity and the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant Human IL-1α is an 18.0kDa protein containing 159 amino acid residues.