| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147369-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp147369-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $349.90 | |
| rp147369-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $529.90 | |
| rp147369-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,699.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-220 aa
| Product Name | Recombinant Human IL-10 R beta Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CDw210b antigen | CDw210b | CRF2-4 | IL-10R subunit 2 | CRFB4 | CRFB4human transmembrane receptor protein | cytokine receptor10 | D21S58 | D21S66 | IBD25 | IL-10 R beta | IL-10 receptor subunit beta | IL10R beta | IL-10R2 | IL-10R subunit beta | IL10RB | |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | When Recombinant Human IL 28 R alpha /IFN lambda R1 Fc Chimera is immobilized at 5.00 μg/mL (100 μL/well), the concentration of Recombinant Human IL-10 R beta Fc Chimera that produces 50% of the optimal binding response is found to be approximately 0.300- |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 20-220 aa |
| Sequence | MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSHHHHHH |
| Protein Tag | C-His |
| Accession # | Q08334 |
| Predicted molecular weight | 23 kDa |
| SDS-PAGE | 75-85 kDa under reducing conditions. |
Recombinant Human IL-10 R beta Protein (rp147369) - SDS-PAGE
3 μg/lane of Recombinant Human IL-10 R beta Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 38 - 45 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708593 | Certificate of Analysis | Jul 25, 2024 | rp147369 |
| 1. Stefanich EG, Rae J, Sukumaran S, Lutman J, Lekkerkerker A, Ouyang W, Wang X, Lee D, Danilenko DM, Diehl L et al.. (2018) Pre-clinical and translational pharmacology of a human interleukin-22 IgG fusion protein for potential treatment of infectious or inflammatory diseases.. Biochem Pharmacol, 152 (3): (224-235). [PMID:29608910] |
| 2. Lutfalla, G G, McInnis, M G MG, Antonarakis, S E SE and Uzé, G G.. (1995) Structure of the human CRFB4 gene: comparison with its IFNAR neighbor.. Journal of molecular evolution, [PMID:7563119] |
| 3. Lutfalla, G G, Gardiner, K K and Uzé, G G.. (1993) A new member of the cytokine receptor gene family maps on chromosome 21 at less than 35 kb from IFNAR.. Genomics, [PMID:8314576] |
| 4. Kotenko, S V SV and 5 more authors.. (1997) Identification and functional characterization of a second chain of the interleukin-10 receptor complex.. The EMBO journal, (1): [PMID:9312047] |
| 5. Xie, M H MH and 8 more authors.. (2000) Interleukin (IL)-22, a novel human cytokine that signals through the interferon receptor-related proteins CRF2-4 and IL-22R.. The Journal of biological chemistry, (6): [PMID:10875937] |
| 6. Sheppard, Paul P and 25 more authors.. (2003) IL-28, IL-29 and their class II cytokine receptor IL-28R.. Nature immunology, [PMID:12469119] |
| 7. Donnelly, Raymond P RP, Sheikh, Faruk F, Kotenko, Sergei V SV and Dickensheets, Harold H.. (2004) The expanded family of class II cytokines that share the IL-10 receptor-2 (IL-10R2) chain.. Journal of leukocyte biology, [PMID:15123776] |
| 8. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 9. Frodsham, Angela J AJ and 16 more authors.. (2006) Class II cytokine receptor gene cluster is a major locus for hepatitis B persistence.. Proceedings of the National Academy of Sciences of the United States of America, (13): [PMID:16757563] |
| 10. Glocker, Erik-Oliver EO and 27 more authors.. (2009) Inflammatory bowel disease and mutations affecting the interleukin-10 receptor.. The New England journal of medicine, (19): [PMID:19890111] |
| 11. Yoon, Sung-Il SI and 8 more authors.. (2010) Structure and mechanism of receptor sharing by the IL-10R2 common chain.. Structure (London, England : 1993), (12): [PMID:20462497] |
