| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147371-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp147371-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $499.90 | |
| rp147371-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $799.90 | |
| rp147371-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,399.90 |
Animal Free, ≥96% (SDS-PAGE&HPLC), Active, E.coli, No tag, 22-199 aa
| Product Name | Recombinant Human IL-11 Protein, ＞96% (SDS-PAGE,HPLC), high purity |
|---|---|
| Synonyms | Adipogenesis inhibitory factor; AGIF; AGIFoprelvekin; IL11; IL-11; IL-11Oprelvekin; interleukin 11; interleukin-11; Oprelvekin |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, High performance |
| Product Description | Function |
| Specifications & Purity | Animal Free, Carrier Free, Bioactive, ActiBioPure™, High performance, ≥96%(SDS-PAGE&HPLC) |
| Purity | ＞96% (SDS-PAGE,HPLC) |
| Bioactivity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <2ng/mL. |
| Endotoxin Concentration | ＜0.01 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 22-199 aa |
| Sequence | GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNL DSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTL EPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIR AAHAILGGLHLTLDWAVRGLLLLKTRL |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P20809 |
| Source | Recombinant |
| Predicted molecular weight | 19.1 kDa |
Recombinant Human IL-11 Protein (rp147371)-Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <2ng/mL.
Recombinant Human IL-11 Protein (rp147371)-SDS-PAGE
3μg/lane of Recombinant Human IL-11 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 18.3 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | For long term storage, the product should be stored ≤ -20℃. 36 months, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -20 to -70℃ under sterile conditions after reconstitution. Upon delivery aliquot. Avo |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0400123 | Certificate of Analysis | May 04, 2023 | rp147371 |
| ZJ23F0400121 | Certificate of Analysis | Apr 29, 2023 | rp147371 |
| ZJ23F0400122 | Certificate of Analysis | Apr 29, 2023 | rp147371 |
| 1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] |
| 2. McKinley, D D, Wu, Q Q, Yang-Feng, T T and Yang, Y C YC.. (1992) Genomic sequence and chromosomal location of human interleukin-11 gene (IL11).. Genomics, [PMID:1386338] |
| 3. Kawashima, I I and 7 more authors.. (1991) Molecular cloning of cDNA encoding adipogenesis inhibitory factor and identity with interleukin-11.. FEBS letters, (3): [PMID:1828438] |
| 4. Paul, S R SR and 9 more authors.. (1990) Molecular cloning of a cDNA encoding interleukin 11, a stromal cell-derived lymphopoietic and hematopoietic cytokine.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2145578] |
| 5. Harmegnies, Dimitri D and 9 more authors.. (2003) Characterization of a potent human interleukin-11 agonist.. The Biochemical journal, (1): [PMID:12919066] |
| 6. Grimwood, Jane J and 97 more authors.. (2004) The DNA sequence and biology of human chromosome 19.. Nature, (1): [PMID:15057824] |
| 7. Putoczki, Tracy L TL, Dobson, Renwick C J RC and Griffin, Michael D W MD.. (2014) The structure of human interleukin-11 reveals receptor-binding site features and structural differences from interleukin-6.. Acta crystallographica. Section D, Biological crystallography, [PMID:25195742] |
