| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147384-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $219.90 | |
| rp147384-20μg | 20μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $319.90 | |
| rp147384-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $599.90 | |
| rp147384-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,099.90 | |
| rp147384-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $5,339.90 |
Animal Free, > 95% (SDS-PAGE), Active, CHO, No tag, Human IL-12 p40 (Ile23-Ser328) & Human IL-12 p35 (Arg23-Ser219)
| Product Name | Recombinant Human IL-12 Protein, ＞ 95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CLMF；CLMF p35；CLMF p40；CLMF1; Cytotoxic lymphocyte maturation factor 35 kDa subunit; IL-12 subunit p35; IL12; IL-12; IL-12, subunit p35; IL12A; interleukin 12, p35; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocytematuration |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity >95% SDS-PAGE. Function Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC. Background Interleukin-12 (IL-12) is a heterodimeric cytokine of 70 kDa(p70 protein) comprising two covalently linked subunits p35 (35 kDa) alpha (α) chain and the p40 (40 kDa) beta (β) chain. The p40 chain is overproduced relative to the p35 chain and forms homodimers that bind to the IL-12 receptor, competing with the bioactive p70 heterodimer for receptor occupancy and thereby serving as a receptor antagonist. IL-12 is predominantly produced by activated dendritic cells (DCs), macrophages, and neutrophils during T-cell priming and acts directly on cytotoxic immune effector cells, including natural killer (NK) cells, natural killer T (NKT) cells, and CD8+ T cells, to stimulate their proliferation and increase their cytotoxic functions. IL-12 is widely accepted as an important regulator of Th1 responses. It also promotes the expansion and survival of activated T-cells and NK cells and modulates the cytotoxic activity of CTLs and NK cells. During the adaptive immune response, IL-12 primes antigen-specific T-cells for high IFN-g production (driving their differentiation toward the Th-1 pathway). IL-12 can also act as an adjuvant for humoral immunity by enhancing production of IgG2a and IgG2b antibodies. Recombinant human IL-12 is a 69-75kDa isodimer glycoprotein (total of 503 amino acid residues) composed of 35 kDa (p35) and 40 kDa (p40) subunits linked by disulfide bonds. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞ 95% (SDS-PAGE) |
| Bioactivity | Recombinant human IL-12 bioactivity is measured in a cell proliferation assay using PHA-P-activated human peripheral blood mononuclear cell (PBMC), the ED₅₀ for this effect is less than 0.04654 ng/mL. |
| Endotoxin Concentration | < 0.01 EU/µg |
| Expression System | CHO |
| Species | Human |
| Amino Acids | Human IL-12 p40 (Ile23-Ser328) +Linker(GSGSSRGGSGSGGSGGGGSK)+ Human IL-12 p35 (Arg23-Ser219) |
| Sequence | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQV |
| Protein Tag | No tag |
| N-terminal Sequence | Ile23 |
| Accession # | P29460 (IL-12p40), P29459 (IL-12p35) |
| Predicted molecular weight | 59 kDa (p40-Linker-p35) |
| SDS-PAGE | 69.8 kDa, under reducing conditions; 61.8 kDa, under non-reducing conditions. |
Recombinant Human IL-12 Protein (rp147384) - Protein Bioactivity
Recombinant human IL-12 bioactivity is measured in a cell proliferation assay using PHA-P-activated human peripheral blood mononuclear cell (PBMC), the ED₅₀ for this effect is less than 0.04654 ng/mL.
Recombinant Human IL-12 Protein (rp147384) - SDS-PAGE
2.5μg/lane of Recombinant Human IL-12 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 69.8 kDa under reducing conditions and 61.8 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute to a concentration of 0.1-1.0 mg/mL in sterile distilled H2O. Stock solutions should be apportioned into working aliquots and stored at-2 |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0700641 | Certificate of Analysis | Jul 21, 2023 | rp147384 |
| ZJ23F0700640 | Certificate of Analysis | Jul 20, 2023 | rp147384 |
