| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147404-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp147404-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $599.90 | |
| rp147404-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $899.90 | |
| rp147404-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,299.90 |
Animal Free, >97% (SDS-PAGE), Active, E. coli., No tag, 49-162 aa
| Product Name | Recombinant Human IL-15 Protein, ＞97% (SDS-PAGE), high purity |
|---|---|
| Synonyms | IL15; IL-15; IL-15MGC9721; interleukin 15; interleukin-15 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity ＞97% SDS-PAGE. Function Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE) |
| Purity | ＞97% (SDS-PAGE) |
| Bioactivity | The ED₅₀ as determined by the dose-dependent stimulation of the proliferation of CTLL-2 cells was found to be ≤ 0.5 ng/ml, corresponding to a specific activity of ≥ 2 x 10⁶ units/mg. |
| Endotoxin Concentration | ＜0.01 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 49-162 aa |
| Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Protein Tag | No tag |
| Accession # | P40933 |
| Predicted molecular weight | 12.9 kDa |
| SDS-PAGE | 10.8 kDa, under reducing conditions; 10.8 kDa, under non-reducing conditions. |
Recombinant Human IL-15 Protein (rp147404) - Protein Bioactivity
Recombinant Human IL-15 stimulates cell proliferation of the CTLL-2 mouse cytotoxic T cell line. The ED₅₀ for this effect is typically less than 0.5 ng/mL.
Recombinant Human IL-15 Protein (rp147404) - SDS-PAGE
3 μg/lane of Recombinant Human IL-15 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.8 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitution Before use this product, please read the direction below carefully. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | For long term storage, the product should be stored ≤-20℃. Please avoid repeated freeze-thaw cycles after reconstitution. 12 months from date of receipt, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -2 |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600493 | Certificate of Analysis | Jul 03, 2023 | rp147404 |
| ZJ23F0600492 | Certificate of Analysis | Jul 03, 2023 | rp147404 |
| ZJ23F0600491 | Certificate of Analysis | Jul 03, 2023 | rp147404 |
| 1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] |
| 2. Quéméner A, Maillasson M, Arzel L, Sicard B, Vomiandry R, Mortier E, Dubreuil D, Jacques Y, Lebreton J, Mathé-Allainmat M. (2017) Discovery of a Small-Molecule Inhibitor of Interleukin 15: Pharmacophore-Based Virtual Screening and Hit Optimization.. J Med Chem, 60 (14): (6249-6272). [PMID:28657314] |
| 3. Żyżyńska-Granica B, Trzaskowski B, Niewieczerzał S, Filipek S, Zegrocka-Stendel O, Dutkiewicz M, Krzeczyński P, Kowalewska M, Koziak K.. (2017) Pharmacophore guided discovery of small-molecule interleukin 15 inhibitors.. Eur J Med Chem, 136 (543-547). [PMID:28535470] |
| 4. Johnston, J A JA and 9 more authors.. (1995) Tyrosine phosphorylation and activation of STAT5, STAT3, and Janus kinases by interleukins 2 and 15.. Proceedings of the National Academy of Sciences of the United States of America, (12): [PMID:7568001] |
| 5. Giri, J G JG and 9 more authors.. (1994) Utilization of the beta and gamma chains of the IL-2 receptor by the novel cytokine IL-15.. The EMBO journal, (15): [PMID:8026467] |
| 6. Grabstein, K H KH and 9 more authors.. (1994) Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor.. Science (New York, N.Y.), (13): [PMID:8178155] |
| 7. Meazza, R R and 8 more authors.. (1996) Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines.. Oncogene, (16): [PMID:8668345] |
| 8. Krause, H H and 5 more authors.. (1996) Genomic structure and chromosomal localization of the human interleukin 15 gene (IL-15).. Cytokine, [PMID:8932977] |
| 9. Badolato, R R, Ponzi, A N AN, Millesimo, M M, Notarangelo, L D LD and Musso, T T.. (1997) Interleukin-15 (IL-15) induces IL-8 and monocyte chemotactic protein 1 production in human monocytes.. Blood, (1): [PMID:9326248] |
| 10. Tagaya, Y Y and 7 more authors.. (1997) Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides.. Proceedings of the National Academy of Sciences of the United States of America, (23): [PMID:9405632] |
| 11. Ratthé, Claude C and Girard, Denis D.. (2004) Interleukin-15 enhances human neutrophil phagocytosis by a Syk-dependent mechanism: importance of the IL-15Ralpha chain.. Journal of leukocyte biology, [PMID:15123770] |
| 12. Ring, Aaron M AM and 12 more authors.. (2012) Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15.. Nature immunology, [PMID:23104097] |
