Recombinant Human IL-21R Protein, ≥92% (SDS-PAGE), high purity

Features and benefits

Expression System: HEK293
Accession #: Q9HBE5
Protein Tag: C-His
Bioactivity: Immobilized Recombinant Human IL21R at 2 μg/mL (100 μL/well) can bind Recombinant Human IL-21 with a linear range of 0.128-5.63 ng/mL.
Endotoxin Concentration: <0.1 EU/μg

Item Number

rp147506

Grouped product items
SKU	Size	Availability	Price
rp147506-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp147506-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$289.90
rp147506-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$409.90
rp147506-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,099.90

Animal Free, ≥92% (SDS-PAGE), Active, 293F, C-His tag, 20-236 aa

View related series

Basic Description

Product Name	Recombinant Human IL-21R Protein, ≥92% (SDS-PAGE), high purity
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥92% SDS-PAGE. Endotoxin level <0.1 EU/µg Function This is a receptor for interleukin-21.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥92%(SDS-PAGE)
Purity	≥92% (SDS-PAGE)
Bioactivity	Immobilized Recombinant Human IL21R at 2 μg/mL (100 μL/well) can bind Recombinant Human IL-21 with a linear range of 0.128-5.63 ng/mL.
Endotoxin Concentration	<0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	20-236 aa
Sequence	CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHHHHHH
Protein Tag	C-His
Accession #	Q9HBE5
Predicted molecular weight	26 kDa
SDS-PAGE	SDS-PAGE: 40-50 kDa under reducing conditions.

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

References

1. Ozaki, K K, Kikly, K K, Michalovich, D D, Young, P R PR and Leonard, W J WJ.. (2000) Cloning of a type I cytokine receptor most related to the IL-2 receptor beta chain.. Proceedings of the National Academy of Sciences of the United States of America, (10): [PMID:11016959]
2. Parrish-Novak, J J and 37 more authors.. (2000) Interleukin 21 and its receptor are involved in NK cell expansion and regulation of lymphocyte function.. Nature, (2): [PMID:11081504]
3. Ueda, Chiyoko C and 8 more authors.. (2002) The gene for interleukin-21 receptor is the partner of BCL6 in t(3;16)(q27;p11), which is recurrently observed in diffuse large B-cell lymphoma.. Oncogene, (17): [PMID:11821949]
4. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161]
5. Hamming, Ole J OJ and 8 more authors.. (2012) Crystal structure of interleukin-21 receptor (IL-21R) bound to IL-21 reveals that sugar chain interacting with WSXWS motif is integral part of IL-21R.. The Journal of biological chemistry, (16): [PMID:22235133]
6. Kotlarz, Daniel D and 25 more authors.. (2013) Loss-of-function mutations in the IL-21 receptor gene cause a primary immunodeficiency syndrome.. The Journal of experimental medicine, (11): [PMID:23440042]

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description