| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147538-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp147538-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $279.90 | |
| rp147538-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $449.90 | |
| rp147538-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-200 aa
| Product Name | Recombinant Human IL-29/IFN-lambda 1 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | cytokine Zcyto21; IFNL1; IFN-lambda 1; IFN-lambda-1; IL29; IL-29; interferon lambda-1; interferon, lambda 1; interleukin 29 (interferon, lambda 1); interleukin-29; ZCYTO21 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured in antiviral assays using HepG2 cells infected with vesicular stomatitis virus. The ED50 for this effect is typically 5-20 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 20-200 aa |
| Sequence | GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHH |
| Protein Tag | C-His |
| Accession # | Q8IU54 |
| Predicted molecular weight | 22 kDa |
| SDS-PAGE | 27-37 kDa under reducing conditions. |
Recombinant Human IL-29/IFN-lambda 1 Protein (rp147538) - SDS-PAGE
3 μg/lane of Recombinant IL-29/IFN-lambda 1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 27 - 37 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404972 | Certificate of Analysis | Apr 30, 2024 | rp147538 |
| ZJ24F0404971 | Certificate of Analysis | Apr 30, 2024 | rp147538 |
| ZJ24F0404970 | Certificate of Analysis | Apr 30, 2024 | rp147538 |
| 1. Sheppard, Paul P and 25 more authors.. (2003) IL-28, IL-29 and their class II cytokine receptor IL-28R.. Nature immunology, [PMID:12469119] |
| 2. Kotenko, Sergei V SV and 9 more authors.. (2003) IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex.. Nature immunology, [PMID:12483210] |
| 3. Grimwood, Jane J and 97 more authors.. (2004) The DNA sequence and biology of human chromosome 19.. Nature, (1): [PMID:15057824] |
| 4. Miknis, Zachary J ZJ and 5 more authors.. (2010) Crystal structure of human interferon-λ1 in complex with its high-affinity receptor interferon-λR1.. Journal of molecular biology, (10): [PMID:20934432] |
