Recombinant Human IL-33 Protein, >95%(SDS-PAGE), high purity

Item Number

rp169652

• Product Name: Recombinant Human IL-33 Protein, >95%(SDS-PAGE), high purity
• Synonyms: C9orf26; C9orf26chromosome 9 open reading frame 26 (NF-HEV); DKFZp586H0523; DVS27; DVS27-related protein; IL1F11; IL-1F11; IL33; IL-33; interleukin 33; Interleukin-1 family member 11; interleukin-33; NFHEV; NF-HEV; NF-HEVNFEHEV; Nuclear factor from high e
• Grade: ActiBioPure™, Azide Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
• Purity: >95%(SDS-PAGE)
• Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized human IL-33 (rp169652) at 2 μg/mL can bind Etokimab (anti-IL-33) (Ab170468) with the EC50 of 20.97 ng/mL.
• Endotoxin Concentration: <1EU/μg
• Expression System: E. coli
• Amino Acids: 112-270 aa
• Sequence: GPSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
• Protein Tag: No tag
• Predicted molecular weight: 18.1 kDa
• SDS-PAGE: 16.3 kDa, reducing conditions; 16.3 kDa, non-reducing conditions

Product Description

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Interleukin 33 (IL-33), also known as DVS27 or NF-HEV (Nuclear Factor from High Endothelial Venules), is a pro-inflammatory protein and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. IL-33 protein is expressed highly and rather selectively by high endothelial venule endothelial cells (HEVECs) in human tonsils, Peyer's patches, and lymph nodes. IL-33 protein has transcriptional regulatory properties, and the researches suggested that IL-33 is a dual-function protein that might act both as a cytokine and as an intracellular nuclear factor. As a type 2 cytokines, IL-33 protein also play a pivotal role in helminthic infection and allergic disorders.