| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147587-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp147587-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $479.90 | |
| rp147587-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $769.90 | |
| rp147587-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-305 aa
| Product Name | Recombinant Human IL-3R alpha/CD123 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CD123 antigen; CD123; hIL3Ra; hIL-3Ra; IL-3 R alpha; IL-3 receptor subunit alpha; IL3R alpha; IL-3R alpha; IL-3R subunit alpha; IL3R; IL3RA; IL-3Ra; IL-3R-alpha; IL3RAY; IL3RX; IL3RY; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor su |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized recombinant Human IL3 at 4 μg/mL (100 μL/well) can bind recombinant Human IL3RA, the EC50 of Human IL3RA is 5.3 μg/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 20-305 aa |
| Sequence | KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRA |
| Protein Tag | C-His |
| Accession # | P26951 |
| Predicted molecular weight | 32 kDa |
| SDS-PAGE | 45.0 - 60.0 kDa, under reducing conditions; 45.0 - 60.0 kDa, under non-reducing conditions. |
Recombinant Human IL-3R alpha/CD123 Protein (rp147587) - Protein Bioactivity
Immobilized Recombinant Human IL-3 at 4.0 μg/mL can bind Recombinant Human IL-3R alpha/CD123 Protein (rp147587), the EC
₅₀
of Human IL-3R alpha/CD123 is 6.2 μg/mL.
Recombinant Human IL-3R alpha/CD123 Protein (rp147587) - SDS-PAGE
3 μg/lane of Recombinant Human IL-3R alpha/CD123 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 45.0 - 60.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404975 | Certificate of Analysis | Apr 30, 2024 | rp147587 |
| ZJ24F0404974 | Certificate of Analysis | Apr 30, 2024 | rp147587 |
| ZJ24F0404973 | Certificate of Analysis | Apr 30, 2024 | rp147587 |
