| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp147593-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp147593-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $499.90 | |
| rp147593-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,799.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 25-153 aa
| Product Name | Recombinant Human IL-4 Protein, ＞98% (SDS-PAGE; HPLC ), high purity |
|---|---|
| Synonyms | B cell growth factor 1|BCDF|B-cell stimulatory factor 1|BCGF1|BCGF-1|binetrakin|BSF1|BSF-1|IL4|IL-4|IL-4B_cell stimulatory factor 1|IL4E12|interleukin 4|interleukin-4|Lymphocyte stimulatory factor 1|MGC79402|Pitrakinra|B-cell stimulatory factor 1|Binetrak |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞98% (SDS-PAGE; HPLC ) |
| Bioactivity | Measured in a cell proliferation assay using TF 1 human erythroleukemic cells. The ED50 for this effect is 85-340 pg/mL, corresponding to a specific activity of 2.94 × 106~1.17× 107 units/mg. |
| Endotoxin Concentration | ＜0.1 EU/µg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 25-153 aa |
| Sequence | HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSHHHHHH |
| Protein Tag | C-His |
| Accession # | P05112 |
| Predicted molecular weight | 15 kDa |
| SDS-PAGE | 20-23 kDa, under reducing conditions |
Recombinant Human IL-4 Protein (rp147593) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 169.3 pg/mL.
Recombinant Human IL-4 Protein (rp147593) - SDS-PAGE
3 μg/lane of Recombinant Human IL-4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 20.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607351 | Certificate of Analysis | Jun 28, 2024 | rp147593 |
| ZJ24F0607350 | Certificate of Analysis | Jun 28, 2024 | rp147593 |
| ZJ24F0607349 | Certificate of Analysis | Jun 28, 2024 | rp147593 |
| 1. Hart TK, Blackburn MN, Brigham-Burke M, Dede K, Al-Mahdi N, Zia-Amirhosseini P, Cook RM. (2002) Preclinical efficacy and safety of pascolizumab (SB 240683): a humanized anti-interleukin-4 antibody with therapeutic potential in asthma.. Clin Exp Immunol, 130 (1): (93-100). [PMID:12296858] |
| 2. Walter, M R MR and 9 more authors.. (1992) Crystal structure of recombinant human interleukin-4.. The Journal of biological chemistry, (5): [PMID:1400355] |
| 3. Wlodawer, A A, Wlodaver, A A, Pavlovsky, A A and Gustchina, A A.. (1992) Crystal structure of human recombinant interleukin-4 at 2.25 A resolution.. FEBS letters, (31): [PMID:1511746] |
| 4. Powers, R R and 5 more authors.. (1992) 1H, 15N, 13C, and 13CO assignments of human interleukin-4 using three-dimensional double- and triple-resonance heteronuclear magnetic resonance spectroscopy.. Biochemistry, (5): [PMID:1567880] |
| 5. Garrett, D S DS and 5 more authors.. (1992) Determination of the secondary structure and folding topology of human interleukin-4 using three-dimensional heteronuclear magnetic resonance spectroscopy.. Biochemistry, (5): [PMID:1567881] |
| 6. Smith, L J LJ and 6 more authors.. (1992) Human interleukin 4. The solution structure of a four-helix bundle protein.. Journal of molecular biology, (20): [PMID:1569578] |
| 7. Redfield, C C and 6 more authors.. (1991) Secondary structure and topology of human interleukin 4 in solution.. Biochemistry, (19): [PMID:1932028] |
| 8. Curtis, B M BM and 8 more authors.. (1991) Experimental and theoretical studies of the three-dimensional structure of human interleukin-4.. Proteins, [PMID:1946344] |
| 9. Carr, C C, Aykent, S S, Kimack, N M NM and Levine, A D AD.. (1991) Disulfide assignments in recombinant mouse and human interleukin 4.. Biochemistry, (12): [PMID:1993171] |
| 10. Arai, N N and 9 more authors.. (1989) Complete nucleotide sequence of the chromosomal gene for human IL-4 and its expression.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:2535858] |
| 11. Yokota, T T and 8 more authors.. (1986) Isolation and characterization of a human interleukin cDNA clone, homologous to mouse B-cell stimulatory factor 1, that expresses B-cell- and T-cell-stimulating activities.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:3016727] |
| 12. Eder, A A, Krafft-Czepa, H H and Krammer, P H PH.. (1988) The 5' region of the human interleukin 4 gene: structure and potential regulatory elements.. Nucleic acids research, (25): [PMID:3257560] |
| 13. Smith, L J LJ and 8 more authors.. (1994) Comparison of four independently determined structures of human recombinant interleukin-4.. Nature structural biology, [PMID:7664036] |
| 14. Malabarba, M G MG and 7 more authors.. (1995) Activation of JAK3, but not JAK1, is critical to interleukin-4 (IL4) stimulated proliferation and requires a membrane-proximal region of IL4 receptor alpha.. The Journal of biological chemistry, (21): [PMID:7721895] |
| 15. Klein, S C SC, Golverdingen, J G JG, Bouwens, A G AG, Tilanus, M G MG and de Weger, R A RA.. (1995) An alternatively spliced interleukin 4 form in lymphoid cells.. Immunogenetics, [PMID:7806280] |
| 16. Müller, T T, Dieckmann, T T, Sebald, W W and Oschkinat, H H.. (1994) Aspects of receptor binding and signalling of interleukin-4 investigated by site-directed mutagenesis and NMR spectroscopy.. Journal of molecular biology, (8): [PMID:8151703] |
| 17. Hage, T T, Sebald, W W and Reinemer, P P.. (1999) Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.. Cell, (16): [PMID:10219247] |
| 18. Hülsmeyer, M M, Scheufler, C C and Dreyer, M K MK.. (2001) Structure of interleukin 4 mutant E9A suggests polar steering in receptor-complex formation.. Acta crystallographica. Section D, Biological crystallography, [PMID:11526337] |
| 19. Zee, Robert Y L RY and 6 more authors.. (2004) Polymorphism in the P-selectin and interleukin-4 genes as determinants of stroke: a population-based, prospective genetic analysis.. Human molecular genetics, (15): [PMID:14681304] |
| 20. LaPorte, Sherry L SL and 7 more authors.. (2008) Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.. Cell, (25): [PMID:18243101] |
| 21. Powers, R R and 5 more authors.. (1992) Three-dimensional solution structure of human interleukin-4 by multidimensional heteronuclear magnetic resonance spectroscopy.. Science (New York, N.Y.), (19): [PMID:1609277] |
