Recombinant Human IL-6 Protein, >95% (SDS-PAGE), high purity

Item Number

rp156005

• Product Name: Recombinant Human IL-6 Protein, >95% (SDS-PAGE), high purity
• Grade: ActiBioPure™, Azide Free, Bioactive, Carrier Free, 高性能
• Specifications & Purity: ActiBioPure™, Bioactive, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
• Purity: >95% (SDS-PAGE)
• Bioactivity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.123 ng/mL. Immobilized Recombinant Human IL-6 Protein (rp156005) at 1.0 μg/mL can bind MEDI-5117 (anti-IL-6) (Ab182698) with the EC50 of 13.84 ng/
• Endotoxin Concentration: ＜1 EU/μg
• Expression System: E. coli
• Amino Acids: 30-212 aa
• Sequence: MGSSHHHHHHSSGLVPRGSHMVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Protein Tag: N-His
• Predicted molecular weight: 23.1 kDa
• SDS-PAGE: 24.1 kDa, under reducing condition

Product Description

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Interleukin-6 (IL-6) is a pleiotropic, alpha-helical, 22-28 kDa phosphorylated and variably glycosylated cytokine that plays important roles in the acute phase reaction, inflammation, hematopoiesis, bone metabolism, and cancer progression. Mature human IL-6 is 183 amino acids (aa) in length and shares 39% aa sequence identity with mouse and rat IL-6. Alternative splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand-binding subunit (IL-6 R alpha) and a signal-transducing subunit (gp130). IL-6 binds to IL-6 R alpha, triggering IL-6 R alpha association with gp130 and gp130 dimerization. Gp130 is also a component of the receptors for CLC, CNTF, CT-1, IL-11, IL-27, LIF, and OSM. Soluble forms of IL-6 R alpha are generated by both alternative splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R alpha elicit responses from gp130-expressing cells that lack cell surface IL-6 R alpha. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R alpha is predominantly restricted to hepatocytes, monocytes, and resting lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/IL-6 R alpha but not from other cytokines that use gp130 as a co-receptor. IL-6, along with TNF-alpha and IL-1, drives the acute inflammatory response and the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. When dysregulated, it contributes to chronic inflammation in obesity, insulin resistance, inflammatory bowel disease, arthritis, sepsis, and atherosclerosis. IL-6 can also function as an anti-inflammatory molecule, as in skeletal muscle where it is secreted in response to exercise. In addition, it enhances hematopoietic stem cell proliferation and the differentiation of Th17 cells, memory B cells, and plasma cells.