Recombinant Human IL-6R alpha Protein

Item Number

rp181252

• Product Name: Recombinant Human IL-6R alpha Protein
• Grade: ActiBioPure™, Animal Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE)
• Bioactivity: 1. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 2.0 μg/mL can bind Recombinant Human IL-6 Protein (rp156005) with the EC50 of 43.35 ng/mL. 2. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Vobarilizu
• Endotoxin Concentration: <1 EU/μg
• Expression System: HEK293
• Amino Acids: 1-365 aa
• Sequence: MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL
• Protein Tag: C-His
• N-terminal Sequence: Leu20
• Predicted molecular weight: 39.4 kDa
• SDS-PAGE: 60.0-80.8 kDa, under reducing conditions; 60.0-80.7kDa, under non-reducing conditions

Product Description

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Protein Function:
The multifunctional factor interleukin 6 (IL-6) exerts its activities through binding to a high-affinity receptor complex consisting of two membrane glycoproteins: an 80 kDa component receptor that binds IL-6 with low affinity (IL-6R alpha ) and a signal-transducing component of 130 kDa (gp130) that does not bind IL-6 by itself, but is required for high-affinity binding of IL-6 by the complex. Both components of the receptor complex, IL-6R alpha and gp130 have been cloned, sequenced, and expressed.
A soluble form of the IL-6R alpha has been found in the urine of healthy adult humans. This soluble receptor apparently arises from proteolytic cleavage of membrane-bound IL-6R alpha. No naturally-occurring mRNA encoding a truncated form of the IL-6R alpha has been reported. Soluble forms of human and murine IL-6R alpha s have been constructed, however, by insertion of termination codons into the regions of the IL-6R alpha cDNAs encoding the external portions of the receptors and prior to the transmembrane domains. These soluble receptors have been expressed in COS-7 and CHO cells and have been shown to bind to IL-6 in solution and to augment the activity of IL-6 as a result of the binding of the IL-6/IL-6R alpha complex to membrane-bound gp130.