Recombinant Human Integrin alpha 4 Protein

Item Number

rp181256

• Product Name: Recombinant Human Integrin alpha 4 Protein
• Grade: Animal Free, Carrier Free
• Specifications & Purity: Animal Free, Carrier Free, ≥95%(SDS-PAGE)
• Bioactivity: Testing in progress
• Endotoxin Concentration: <1 EU/μg
• Expression System: HEK293
• Amino Acids: 1-970 aa
• Sequence: MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSV
• Protein Tag: C-TEV-Acidic tail-His
• Predicted molecular weight: 109.6 kDa
• SDS-PAGE: 95.8 kDa, under reducing conditions; 92.3 kDa, under non-reducing conditions

Product Description

Protein Function:
Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. ITGA4 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGA4 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1. Integrin ITGA4 represses PRKCA-mediated L-type voltage-gated channel Ca2+ influx and ROCK-mediated calcium sensitivity in vascular smooth muscle cells via its interaction with SVEP1, thereby inhibiting vasocontraction.